SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111513 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111513
Domain Number 1 Region: 577-861
Classification Level Classification E-value
Superfamily ARM repeat 9.7e-24
Family Armadillo repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 856-933
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.45e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 1005-1148
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000641
Family Toll/Interleukin receptor TIR domain 0.007
Further Details:      
 
Domain Number 4 Region: 937-999
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000222
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111513   Gene: FBgn0085402   Transcript: FBtr0112601
Sequence length 1562
Comment type=protein; loc=3L:join(8072616..8072741,8086159..8086437,8091446..8091825,8092246..8092636,8095993..8097918,8097980..8098159,8098227..8098396,8098540..8098757,8099116..8100049,8101739..8101823); ID=FBpp0111513; name=Ect4-PG; parent=FBgn0085402,FBtr0112601; dbxref=FlyBase:FBpp0111513,FlyBase_Annotation_IDs:CG34373-PG,REFSEQ:NP_001097544,GB_protein:ABW08491,FlyMine:FBpp0111513,modMine:FBpp0111513; MD5=ffab0fe5e5b2ce3376ad37a6d18a7412; length=1562; release=r5.30; species=Dmel;
Sequence
MVVTSTRSPLLAQTQPANASTSGTHTSAALRSRLIFPRQHYQMTDFSDSSPSGVLSPPTS
LIENFHKKNSSPQPLGSSSAISTLTPTTLNGSVVGGGVGGAGHHSIENGRQINTSSSSCS
SLKETSHQSTSTSQQVVNSSSSTTTRVEKKSQRLHHHITSSSSSSSTTQALSTSSEMKAA
EIKRDLTNIQKSMSEINDLAKERITGGPGSISTTSASAITAPSTMSQTTTSRLAPKLTSA
HPSIDDLRGLSRQDKITQLQKKIRASFENLVDHDDSNVIVTLPDDDDCPHNHFGSGLNLT
HPTAAQLSASGLSGSSKTIDTIKFQEKSMKTESKTKVVTDGFSSEQATSNSAEMKRLQAG
DIDYQESKGASAMRNRLEVDGVKTEENAAVIKEALSLRTGDITQQASNNVAASSITVQSE
NFSADKKAISQSQQSQTMTSNGIISQEKHVSSASQANYSMSHKGVSSTGSSMITSSSQMS
AMNGQMLKLADLKLDDLKSLTAGSGQQEIEQTINKYSNMLTSIVSSLQEDERGGSAITVH
DVGGKKSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSS
AQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSD
VIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHN
DDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKH
WLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIA
SKFAAQALRLIGETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYIDKFNESQVDGDLLLKL
NQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAKMHQFLSEIGTDYCTYTYAML
NAGIDKCALPHVNEDMLMTECGIHNSIHRLRILNAVKNLENSLPSSSEENMAKTLDVFVS
YRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIRQAKNFVLVLTPDALH
RCINDEDCKDWVHREIVAALNSNCNIIPIIDQQFDWPEVERLPEDMRSVAHFNGVNWIHD
YQDACIDKLERFLRGEKNIDRIAAMVPGTPGSVSYQRMHSNDSDYQSGGAGAGSGAGTGG
GGGGGVTGSVVDGLMVAANGSGQANHQANRYRQSPSPARQRGSTSQLSGYSRAPSKRSQI
LTPYRTQQAALLHKTGAGSASMQNMMPLAYLPPRRSSAAGLGHGSGSGMGSGYRSHSVDG
LLDQAGSTPEQRIAAAAAKVTAGSTALTNASSTSTLQPEEEVTDAALNDSVTRRDKHTLS
PPGNVQQHRKSRSLDHILSKQTLAELLPPSSELADGTQSMQNLAIPMTPQPQRRDTSSSS
KSPTPERPPQPAMERVRERQSPEGVSATESEREDQPEECLRHGNQQRASASVHRGASLTS
NKTSNSSLGSNFSAGGNNKTIFNRTMKKVRSLIKNNEMEDEELSGIILSKATSPNAGRMI
FW
Download sequence
Identical sequences A8JNN2
NP_001097544.1.81976 FBpp0111513 FBpp0293533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]