SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111988 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111988
Domain Number 1 Region: 45-169
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.66e-25
Family Hormone receptor domain 0.00066
Further Details:      
 
Domain Number 2 Region: 128-446
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000503
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111988   Gene: FBgn0033744   Transcript: FBtr0113075
Sequence length 476
Comment type=protein; loc=2R:join(8368439..8368678,8372044..8372161,8372214..8372415,8372471..8372567,8372622..8372715,8372774..8372934,8372996..8373106,8373173..8373358,8373419..8373543,8374314..8374410); ID=FBpp0111988; name=CG12370-PB; parent=FBgn0033744,FBtr0113075; dbxref=FlyBase:FBpp0111988,FlyBase_Annotation_IDs:CG12370-PB,REFSEQ:NP_610789,GB_protein:AAM68690,FlyMine:FBpp0111988,modMine:FBpp0111988; MD5=aafb77b7d079c86bf8d0fd7777e40710; length=476; release=r5.30; species=Dmel;
Sequence
MADDDLRALVDSLDDASQEDLAKVIANFSVDMLQRASALIGAQQGSSGGQLQNRTLQCQQ
QQQREEEQASLEALASGGKRILQCPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTD
NATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVAL
IIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFY
LTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENE
HFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLETRQYYK
ASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQ
TLRHGFTRWRESRNIHRNSSIKNRSTEECVICLRPSPHTRLGSLQRYHSIDITDFV
Download sequence
Identical sequences E2QCM9
FBpp0111988 FBpp0111988 FBpp0111988 NP_610789.3.81976 7227.FBpp0111988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]