SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0112297 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112297
Domain Number 1 Region: 235-280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000707
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 2 Region: 190-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112297   Gene: FBgn0051092   Transcript: FBtr0113385
Sequence length 380
Comment type=protein; loc=3R:complement(21525707..21525748,21527031..21527177,21527247..21527383,21539564..21539683,21548138..21548278,21564777..21565332); ID=FBpp0112297; name=LpR2-PD; parent=FBgn0051092,FBtr0113385; dbxref=FlyBase:FBpp0112297,FlyBase_Annotation_IDs:CG31092-PD,REFSEQ:NP_001097927,GB_protein:ABW08767,FlyMine:FBpp0112297,modMine:FBpp0112297; MD5=1954e4b1f2c849714d520b5bc8371659; length=380; release=r5.30; species=Dmel;
Sequence
MATTCMPHFTEYFQTTTQSELTTNESANSRSSSSSSGCREPSKTSGFFYSASTHYQSKVQ
QLISFSFTSSFHLLFITCILSISKFCNAAAVNAAHVTAATPTASEIMHNLSGSALLERLK
ASTLGPTLDQLKHLAPAAANSISPGTGSGMGIGMGHFGSSINSVLNGNPLKFLNVSGKIG
TPLDISLGLSNYCDEKQFQCSTGECIPIRFVCDGSSDCPDHSDERLEECKFTESTCSQEQ
FRCGNGKCIPRRWVCDRENDCADGSDESTSQCLETKTGNNRTDTSNQVHKSDAESENDYV
EIALHVIASLAGTALVASVIYVVYRRCTRAVNSMNFENPVYHKTTEDHFSLEKNGTPHIY
AAANDEEAVNPLFKSGTECV
Download sequence
Identical sequences Q6NN57
FBpp0112297 NP_001097927.1.81976 FBpp0112297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]