SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288445 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288445
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000144
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 623-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000455
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 2389-2433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000202
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000487
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2221-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000567
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000077
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 14102-14125
Classification Level Classification E-value
Superfamily DPY module 0.00000484
Family DPY module 0.00058
Further Details:      
 
Domain Number 11 Region: 20371-20394
Classification Level Classification E-value
Superfamily DPY module 0.00000536
Family DPY module 0.00085
Further Details:      
 
Domain Number 12 Region: 1429-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000568
Family EGF-type module 0.028
Further Details:      
 
Domain Number 13 Region: 10264-10287
Classification Level Classification E-value
Superfamily DPY module 0.0000085
Family DPY module 0.001
Further Details:      
 
Domain Number 14 Region: 17208-17231
Classification Level Classification E-value
Superfamily DPY module 0.00000942
Family DPY module 0.00093
Further Details:      
 
Domain Number 15 Region: 13996-14019
Classification Level Classification E-value
Superfamily DPY module 0.00000955
Family DPY module 0.00098
Further Details:      
 
Domain Number 16 Region: 10599-10753
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000973
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 17 Region: 19609-19632
Classification Level Classification E-value
Superfamily DPY module 0.00000994
Family DPY module 0.00087
Further Details:      
 
Domain Number 18 Region: 13683-13706
Classification Level Classification E-value
Superfamily DPY module 0.0000123
Family DPY module 0.001
Further Details:      
 
Domain Number 19 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 15292-15315
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00091
Further Details:      
 
Domain Number 21 Region: 18615-18638
Classification Level Classification E-value
Superfamily DPY module 0.0000157
Family DPY module 0.00095
Further Details:      
 
Domain Number 22 Region: 15720-15743
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.0012
Further Details:      
 
Domain Number 23 Region: 16037-16060
Classification Level Classification E-value
Superfamily DPY module 0.0000196
Family DPY module 0.00087
Further Details:      
 
Domain Number 24 Region: 14741-14764
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00091
Further Details:      
 
Domain Number 25 Region: 14844-14867
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.0013
Further Details:      
 
Domain Number 26 Region: 17313-17336
Classification Level Classification E-value
Superfamily DPY module 0.0000209
Family DPY module 0.00093
Further Details:      
 
Domain Number 27 Region: 11337-11360
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.0011
Further Details:      
 
Domain Number 28 Region: 15397-15420
Classification Level Classification E-value
Superfamily DPY module 0.0000222
Family DPY module 0.00083
Further Details:      
 
Domain Number 29 Region: 14635-14658
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.001
Further Details:      
 
Domain Number 30 Region: 18493-18516
Classification Level Classification E-value
Superfamily DPY module 0.0000248
Family DPY module 0.0011
Further Details:      
 
Domain Number 31 Region: 20166-20326
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 32 Region: 9941-9964
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.00089
Further Details:      
 
Domain Number 33 Region: 16568-16591
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0014
Further Details:      
 
Domain Number 34 Region: 13788-13811
Classification Level Classification E-value
Superfamily DPY module 0.0000314
Family DPY module 0.0013
Further Details:      
 
Domain Number 35 Region: 9834-9857
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.001
Further Details:      
 
Domain Number 36 Region: 10802-10825
Classification Level Classification E-value
Superfamily DPY module 0.0000327
Family DPY module 0.0012
Further Details:      
 
Domain Number 37 Region: 10909-10932
Classification Level Classification E-value
Superfamily DPY module 0.0000353
Family DPY module 0.0013
Further Details:      
 
Domain Number 38 Region: 14318-14341
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.00093
Further Details:      
 
Domain Number 39 Region: 16357-16380
Classification Level Classification E-value
Superfamily DPY module 0.0000366
Family DPY module 0.0011
Further Details:      
 
Domain Number 40 Region: 18172-18195
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0011
Further Details:      
 
Domain Number 41 Region: 18279-18302
Classification Level Classification E-value
Superfamily DPY module 0.0000379
Family DPY module 0.0019
Further Details:      
 
Domain Number 42 Region: 17954-17977
Classification Level Classification E-value
Superfamily DPY module 0.0000392
Family DPY module 0.0011
Further Details:      
 
Domain Number 43 Region: 12936-12959
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0013
Further Details:      
 
Domain Number 44 Region: 13572-13595
Classification Level Classification E-value
Superfamily DPY module 0.0000405
Family DPY module 0.0015
Further Details:      
 
Domain Number 45 Region: 20051-20074
Classification Level Classification E-value
Superfamily DPY module 0.0000445
Family DPY module 0.001
Further Details:      
 
Domain Number 46 Region: 13360-13383
Classification Level Classification E-value
Superfamily DPY module 0.0000484
Family DPY module 0.0014
Further Details:      
 
Domain Number 47 Region: 9518-9541
Classification Level Classification E-value
Superfamily DPY module 0.0000497
Family DPY module 0.0013
Further Details:      
 
Domain Number 48 Region: 9198-9221
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0015
Further Details:      
 
Domain Number 49 Region: 9729-9752
Classification Level Classification E-value
Superfamily DPY module 0.0000589
Family DPY module 0.0017
Further Details:      
 
Domain Number 50 Region: 18720-18743
Classification Level Classification E-value
Superfamily DPY module 0.0000602
Family DPY module 0.0018
Further Details:      
 
Domain Number 51 Region: 17848-17871
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0016
Further Details:      
 
Domain Number 52 Region: 19716-19739
Classification Level Classification E-value
Superfamily DPY module 0.0000615
Family DPY module 0.0014
Further Details:      
 
Domain Number 53 Region: 20696-20719
Classification Level Classification E-value
Superfamily DPY module 0.000068
Family DPY module 0.0011
Further Details:      
 
Domain Number 54 Region: 14529-14552
Classification Level Classification E-value
Superfamily DPY module 0.0000706
Family DPY module 0.0014
Further Details:      
 
Domain Number 55 Region: 11767-11790
Classification Level Classification E-value
Superfamily DPY module 0.0000719
Family DPY module 0.0012
Further Details:      
 
Domain Number 56 Region: 12189-12212
Classification Level Classification E-value
Superfamily DPY module 0.0000719
Family DPY module 0.0013
Further Details:      
 
Domain Number 57 Region: 910-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000734
Family EGF-type module 0.021
Further Details:      
 
Domain Number 58 Region: 1017-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000778
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 59 Region: 16675-16698
Classification Level Classification E-value
Superfamily DPY module 0.0000837
Family DPY module 0.001
Further Details:      
 
Domain Number 60 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000891
Family EGF-type module 0.025
Further Details:      
 
Domain Number 61 Region: 17437-17591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000926
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 62 Region: 16781-16804
Classification Level Classification E-value
Superfamily DPY module 0.0000968
Family DPY module 0.0015
Further Details:      
 
Weak hits

Sequence:  FBpp0288445
Domain Number - Region: 9626-9649
Classification Level Classification E-value
Superfamily DPY module 0.000107
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13045-13068
Classification Level Classification E-value
Superfamily DPY module 0.000114
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 13150-13173
Classification Level Classification E-value
Superfamily DPY module 0.000115
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 16995-17018
Classification Level Classification E-value
Superfamily DPY module 0.000115
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 10048-10071
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 12614-12637
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 15503-15526
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 16142-16165
Classification Level Classification E-value
Superfamily DPY module 0.000144
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 12406-12429
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 15184-15207
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17740-17763
Classification Level Classification E-value
Superfamily DPY module 0.000157
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11871-11894
Classification Level Classification E-value
Superfamily DPY module 0.00017
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 10484-10507
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 11976-11999
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 20894-20916
Classification Level Classification E-value
Superfamily DPY module 0.000183
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 1334-1479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 9304-9326
Classification Level Classification E-value
Superfamily DPY module 0.000196
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 11017-11040
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 9410-9433
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 15615-15638
Classification Level Classification E-value
Superfamily DPY module 0.000222
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 14209-14232
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 17635-17658
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 13466-13489
Classification Level Classification E-value
Superfamily DPY module 0.000262
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 14425-14448
Classification Level Classification E-value
Superfamily DPY module 0.000275
Family DPY module 0.0018
Further Details:      
 
Domain Number - Region: 11247-11396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000282
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 20802-20824
Classification Level Classification E-value
Superfamily DPY module 0.000314
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12827-12850
Classification Level Classification E-value
Superfamily DPY module 0.000327
Family DPY module 0.0013
Further Details:      
 
Domain Number - Region: 12512-12535
Classification Level Classification E-value
Superfamily DPY module 0.00034
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 12086-12109
Classification Level Classification E-value
Superfamily DPY module 0.000353
Family DPY module 0.0014
Further Details:      
 
Domain Number - Region: 13891-13914
Classification Level Classification E-value
Superfamily DPY module 0.000379
Family DPY module 0.0011
Further Details:      
 
Domain Number - Region: 10158-10181
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17101-17124
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0019
Further Details:      
 
Domain Number - Region: 17420-17443
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 15728-15880
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000439
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 11125-11148
Classification Level Classification E-value
Superfamily DPY module 0.000445
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 14918-15017
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000455
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 13252-13275
Classification Level Classification E-value
Superfamily DPY module 0.000615
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 18348-18441
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000738
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number - Region: 12720-12743
Classification Level Classification E-value
Superfamily DPY module 0.000759
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 19846-20001
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000816
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number - Region: 10374-10397
Classification Level Classification E-value
Superfamily DPY module 0.00085
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 16890-16913
Classification Level Classification E-value
Superfamily DPY module 0.00085
Family DPY module 0.0015
Further Details:      
 
Domain Number - Region: 17702-17735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 2342-2501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000926
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 11657-11680
Classification Level Classification E-value
Superfamily DPY module 0.00144
Family DPY module 0.0023
Further Details:      
 
Domain Number - Region: 14750-14903
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 15842-15989
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00165
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 11087-11120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0017
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 20494-20644
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 12295-12318
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 15059-15082
Classification Level Classification E-value
Superfamily DPY module 0.00183
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 16216-16312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 15300-15456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 21341-21364
Classification Level Classification E-value
Superfamily DPY module 0.00209
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 21471-21494
Classification Level Classification E-value
Superfamily DPY module 0.00235
Family DPY module 0.0017
Further Details:      
 
Domain Number - Region: 18454-18488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00252
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 9795-9829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00262
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 17966-18123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00267
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 17914-17948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00284
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 17064-17096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 9090-9113
Classification Level Classification E-value
Superfamily DPY module 0.00301
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 17810-17843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00325
Family Merozoite surface protein 1 (MSP-1) 0.061
Further Details:      
 
Domain Number - Region: 20960-20983
Classification Level Classification E-value
Superfamily DPY module 0.00366
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 12049-12081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 19799-19832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00568
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 9586-9619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00656
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 21082-21105
Classification Level Classification E-value
Superfamily DPY module 0.00772
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 984-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00948
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 10056-10216
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0102
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 8770-8806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 11858-12035
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.013
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 11441-11464
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 20440-20473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0149
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 17383-17415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0154
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 14537-14692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0155
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 22117-22139
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.002
Further Details:      
 
Domain Number - Region: 20120-20153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0162
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 8989-9010
Classification Level Classification E-value
Superfamily DPY module 0.0183
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 10978-11012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0187
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 12837-12998
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 17170-17203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0197
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 20478-20501
Classification Level Classification E-value
Superfamily DPY module 0.0222
Family DPY module 0.0031
Further Details:      
 
Domain Number - Region: 11510-11543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 19570-19604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 790-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0271
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 20763-20795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 15580-15676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 18577-18609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.033
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 13010-13106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 16470-16627
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 11404-11436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 9313-9469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.04
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 14702-14735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0405
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 12626-12778
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0424
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 20015-20045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0447
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 9051-9084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0449
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 13647-13742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0455
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 13593-13625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0524
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 10010-10043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0539
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 13854-13886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0549
Family EGF-like domain of nidogen-1 0.051
Further Details:      
 
Domain Number - Region: 12576-12609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.055
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 21282-21303
Classification Level Classification E-value
Superfamily DPY module 0.0562
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 12151-12183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0569
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 8902-8935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0595
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 8620-8779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0596
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 22370-22392
Classification Level Classification E-value
Superfamily DPY module 0.0615
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 22308-22328
Classification Level Classification E-value
Superfamily DPY module 0.0667
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 15254-15287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0689
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 12786-12821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0692
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 20656-20684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0709
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 18682-18715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.074
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 16046-16204
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0769
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 12198-12356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 22191-22211
Classification Level Classification E-value
Superfamily DPY module 0.0824
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 876-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 11194-11227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0954
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 13429-13460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0978
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288445   Gene: FBgn0053196   Transcript: FBtr0290006
Sequence length 22971
Comment type=protein; loc=2L:complement(4479538..4479779,4479844..4480269,4480334..4483561,4483635..4484630,4484692..4484886,4484948..4485148,4485508..4487193,4487449..4488387,4488454..4489113,4489668..4490318,4490376..4493720,4493799..4494104,4494171..4496159,4496247..4497209,4497276..4497923,4497984..4498298,4498362..4499960,4500025..4500339,4500404..4501666,4501726..4502064,4502140..4502451,4502517..4503164,4503221..4503526,4503585..4503899,4503958..4504290,4504354..4504671,4504777..4506093,4506154..4506498,4506559..4506870,4506934..4507878,4507939..4508247,4508311..4508649,4508713..4509024,4509082..4509726,4509782..4510396,4510466..4510801,4510859..4511176,4511231..4511878,4511933..4512235,4512290..4512586,4512650..4512994,4513056..4513376,4513435..4513761,4515397..4518588,4518710..4520299,4520377..4520703,4521043..4521351,4521417..4521755,4521813..4522442,4522641..4522964,4523031..4523357,4523752..4524069,4524298..4524624,4524691..4525023,4525087..4525404,4525604..4525927,4526224..4526541,4526606..4527229,4527296..4529728,4529792..4530277,4530531..4530713,4530832..4531053,4531353..4531970,4532103..4532180,4532243..4532386,4533571..4534974,4535244..4538827,4538913..4540356,4540442..4546933,4548005..4548802,4552243..4552335,4552397..4554205,4554351..4554659,4555206..4562483,4563111..4563467,4563680..4564189,4570479..4570595,4570680..4570781,4570857..4571085,4574284..4574337); ID=FBpp0288445; name=dp-PC; parent=FBgn0053196,FBtr0290006; dbxref=FlyBase:FBpp0288445,FlyBase_Annotation_IDs:CG33196-PC,REFSEQ:NP_787974,GB_protein:AAN10358,FlyMine:FBpp0288445,modMine:FBpp0288445; MD5=af10e5bf6ff37d2b27dfdd5796ef48f7; length=22971; release=r5.30; species=Dmel;
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCI
CRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAAN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGD
GALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEE
DKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECGPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELTCAPDKRECYRDDDCASNMAC
SDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQ
AHQCGSSGKCIDPCLTSCAGGVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQ
RIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGPYTTTTESYKTTKQLSSNPET
ETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTL
PSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTTPSESPETPT
TLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTES
TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIR
VEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSA
SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVP
IGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYS
DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE
VRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSAD
RTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLE
TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDF
TTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPT
TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTL
PSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTV
PSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECT
RDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESP
ETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTP
SPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTS
PSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSES
PETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQ
TTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEAST
PSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT
TPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETT
TSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSE
SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPI
GSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDR
TSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSET
TTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTT
SSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTT
QPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP
SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTT
LPSDFTTRPHSDQTTESTRDVPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQ
VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST
RDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVT
LEIAVPPVTSETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSES
PETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPI
GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTG
GQVAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSEVRTTI
RVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSE
IPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDA
LETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTV
FNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTF
NNPCSRNEDCRVFNHQPLCSAEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNS
TSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTTTTSSTSTESSTITSATNQTS
KNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK
MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCA
PNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTA
KSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATN
AVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED
SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQC
GAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPK
GLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCD
PSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP
VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGC
REPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSK
ACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPC
GRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG
INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGV
ALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPV
CACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPH
IGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA
CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECA
PNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVP
KNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQN
PCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV
CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAEC
TVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVG
YFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEG
NPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN
QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLD
PPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMK
CRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCG
LFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNA
RCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSS
GAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPV
CMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPY
VECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVG
CHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSS
SECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPI
THDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACI
NLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPC
GANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGV
SAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVC
SCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCP
AGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPN
CRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCN
PQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSR
DKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDE
NPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDP
CPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNS
KCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCT
VIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCAC
LPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFD
GYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPEC
VVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEV
KNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQER
CVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCG
PHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNIC
GDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQ
AVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPIC
TCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFI
GAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDP
FVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADC
PRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIE
ACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPC
AAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPN
SICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAEC
RVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEY
QGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTG
DPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTV
NAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPP
PGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQA
CIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDP
CDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVC
GQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVC
ACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCN
TGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR
PECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKE
QERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNK
ACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQ
PCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPC
PGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNS
QCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGSCGYAAECS
VVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAE
FHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTA
GSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSE
CAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDV
APVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKC
VDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNA
VCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANC
QVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSC
LPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCIS
GYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAP
NCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNC
NPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRD
RACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPS
PCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCG
FNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSP
SCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCL
CDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDG
CRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICR
ITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAA
DKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREP
LDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRD
PCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCG
SNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICE
VLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITS
FIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTG
NPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVT
SSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQEL
DQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQK
CQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQ
CREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRV
VNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPAC
SCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTCP
PGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRP
ECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTP
RKYFPSRPCSKPNDTQLNDFLPAPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTP
PLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVG
CQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSE
CPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIIN
PCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDP
CPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNC
REVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVR
NHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAV
CSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVC
LRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACR
PECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPV
QLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQN
QRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSP
CGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGT
DAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVG
SCQCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTC
NCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPG
CRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCY
PIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSE
CLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPV
ALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDP
CPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRV
FNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNH
APICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEY
IGTPPNCRPECITNSECSFDKACLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGD
PFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVT
NNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVL
KEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQK
CNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSP
CGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGF
NALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQC
NCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHC
PPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSC
RPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHR
PPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMN
LACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVP
SPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGT
CGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRES
NNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHS
PHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCL
PGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGY
EGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVL
NTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPV
VPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQC
RDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCG
PNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAA
TCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQ
CLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCY
PGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPAC
RPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQS
LPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSD
CPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPV
TVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCL
DPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGE
CREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHV
INHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCR
CLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAP
GLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSC
VCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRC
FSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCR
PECTLNSECAYDKACVHHKCVDPCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYET
PKPVRPQIYDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQ
PANPQKPGVVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRP
VFITSPGNLSPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVP
SPSYPAPNPPVNYPTQPSPQIPVQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPG
VINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPSAPQPVHPAPNPPVHEFNY
PTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTP
QAPVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIP
SVAQPVHPTYQPPVVERPAIYDVYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLH
IPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSPPVPGIVNIPSLPQPVSTPTSGV
INIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSV
PQPLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPT
PGVINIPSVSQPTYPTQKPSYQDTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPS
EPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQAIPGVVNVPSAPQPTPGR
PYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPS
SLACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIE
AKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPC
PGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPI
NPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDP
CPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSE
CQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRV
VAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLP
GYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGH
VGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPE
CVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPP
PQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNL
ACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPC
QPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCG
LNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNG
NAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAH
CECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGT
PPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFR
ICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECV
GNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPP
PPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINS
KCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNG
ICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPP
EFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQL
HRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADF
NHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHR
AQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAIC
EVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLD
ASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRC
QDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNEN
CVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDR
LNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADC
PSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVP
KVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIE
CYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCP
PGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPIC
YCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRAN
CRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRA
VCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCS
VLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNC
GTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDP
CGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHN
PCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPC
VVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTD
KSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVC
RNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKAC
VNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPS
QKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVI
EKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCT
CPIDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAV
NHRAQCQCITGYTGNPDLHCNHTNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYV
KGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVASFVLVIQKHPKLVTYKAQ
AYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNL
KLQVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLL
ASFNAFKFPSSDNIRFQCNIRVCFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSG
VEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDICVSMVGLIIALVITALLA
LVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Download sequence
Identical sequences FBpp0288445 7227.FBpp0288445 FBpp0288445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]