SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289287 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289287
Domain Number 1 Region: 459-553
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000323
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 565-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289287   Gene: FBgn0003984   Transcript: FBtr0300010
Sequence length 618
Comment type=protein; loc=3L:complement(5806534..5806574,5809751..5809800,5810635..5810743,5810998..5811125,5811209..5811386,5835308..5836658); ID=FBpp0289287; name=vn-PC; parent=FBgn0003984,FBtr0300010; dbxref=FlyBase_Annotation_IDs:CG10491-PC,FlyBase:FBpp0289287,REFSEQ:NP_001014565,GB_protein:AAX52759,FlyMine:FBpp0289287,modMine:FBpp0289287; MD5=35d7d5feaba7fdcad6835d1bd7405547; length=618; release=r5.30; species=Dmel;
Sequence
MYAQHLRKWSLKTKKQLMPLILLIISYMLLLNTCVLSSSATTQQQQQQQQQQQHLPRLWE
GSAEESSYYIPLSSDNGSGSSESSAESGSSSSRSSSNNIDNNILSRLLSLNSNSLSSRSN
VKLKPATVFDAGSSTPAQQEQHVAAVPEQQQQQQQQQQSMQKVPNTLINSQIYNLLYNGM
PSEAASSKMRRHIQPSQLPHQPESRAQLPSNYSSRPAVRSYLIESYEMPESMLEDRSPEQ
AARSRRDGSNTNGSRQQQRTGHRQQLQQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQ
QQQQQRRKHQRKHQRYNRYCSARDPAQLAFAAPTVFQGVFKSMSADRRVNFSATMKVEKV
YKQQHDLQLPTLVRLQFALSNSSGECDIYRERLMPRGMLRSGNDLQQASDISYMMFVQQT
NPGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEV
SGQPPPKVTWFKDEKSINRKRNIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKNKASKA
IAKRRIMIKASPVHFPTDRSASGIPCNFDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCE
NKWPDISWQEYDEPDGTH
Download sequence
Identical sequences Q59E20
FBpp0289287 NP_001014565.2.81976 FBpp0289287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]