The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
Sequence: |
FBpp0289360 |
Domain Number 1 |
Region: 547-810 |
Classification Level |
Classification |
E-value |
Superfamily |
NHL repeat |
4.18e-43 |
Family |
NHL repeat |
0.0000614 |
Further Details: |
|
|
Domain Number 2 |
Region: 181-240 |
Classification Level |
Classification |
E-value |
Superfamily |
B-box zinc-binding domain |
0.0000000000244 |
Family |
B-box zinc-binding domain |
0.0036 |
Further Details: |
|
|
Sequence: |
FBpp0289360 |
Domain Number - |
Region: 123-163 |
Classification Level |
Classification |
E-value |
Superfamily |
B-box zinc-binding domain |
0.00604 |
Family |
B-box zinc-binding domain |
0.0053 |
Further Details: |
|
|
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Molecular Function |
IC (bits) |
H-Score |
Cellular Component |
IC (bits) |
H-Score |
Biological Process |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0289360 Gene: FBgn0259745 Transcript: FBtr0300083 |
Sequence length |
832 |
Comment |
type=protein; loc=2R:complement(3370899..3371069,3371152..3371304,3371367..3373320,3373390..3373610); ID=FBpp0289360; name=wech-PD; parent=FBgn0259745,FBtr0300083; dbxref=FlyBase:FBpp0289360,FlyBase_Annotation_IDs:CG42396-PD,REFSEQ:NP_001137614,GB_protein:ACL83068; MD5=12054328bfeaaa398213d13a5976da9e; length=832; release=r5.30; species=Dmel; |
Sequence |
MMELLSNNSVPQQMASSNAPSANNVAHSSTANGSGGGSVSSNASNSSERLLAGILESFPA
WDLNVGLLPNVGQSSPPRADFFINNFLGGLDTHGDFSIGPIGSGARSNPKMSPESSNNSS
ISCGWCEVSASIRCLECNEFMCNDCLREHRNSPLSSNHSIVSLPTPIGASPTGGSSVNAQ
TPPSGNFICDIHNEMLRYVCDYCRKLVCQCCTLHEHKEHSYASIQSFMVGSKEKLEGAIE
SSQVGTRCIKSSIDKALAFIRLIERNCSELSDNIRKAFRQFIIAIEDRERFLLDFVEKLR
QRRLAILHDQMAGLKSALAGLSETSDMLSKVADNACNMDQIEIAMKLTNGQRQMEQFAGI
YKDLQPKQEVFAFAPPDYSLLQDIRNQGGVILVDDKNLPIVSSSNGIVPSVSSVNAVAAA
SVGVVGGVAGVVGGVGVSNGLDLAFGMNMPNNPLSVASSSVRRPLLRDNSFRIPSPIMQP
RGGSACGMSSGMSSAALDWELNGLRSSPGLHFSAPRTTQAIPGCMDLVKVRNSNALSLSF
ATEGHEDGQVSRPWGLCVDKMGHVLVSDRRNNRVQVFNPDGSLKFKFGRKGVGNGEFDLP
AGICVDVDNRIIVVDKDNHRVQIFTASGVFLLKFGSYGKEYGQFQYPWDVAVNSRRQIVV
TDSRNHRIQQFDSEGRFIRQIVFDNHGQTKGIASPRGVCYTPTGNIIVSDFDNHCLYLID
PDINDILSVKGHEGSGFHEFNRPSGLCCDDEGRIIVADSKNQRILVFNQNLDFMWDIEVR
PSINPLMPPTLDEKDRTCDVAIMPDGRIVFLIELSPDSKEGSNPYKRFVHVF
|
Download sequence |
 |
Identical sequences |
Q9V4M2
NP_001137614.1.81976 NP_001137615.1.81976 NP_524772.2.81976 NP_724567.1.81976 NP_724568.1.81976 FBpp0289357 FBpp0289358 FBpp0289359 FBpp0289360 FBpp0289361 7227.FBpp0289360 FBpp0289357 FBpp0289358 FBpp0289359 FBpp0289360 FBpp0289361 FBpp0289357 |