SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289361 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289361
Domain Number 1 Region: 547-810
Classification Level Classification E-value
Superfamily NHL repeat 4.18e-43
Family NHL repeat 0.0000614
Further Details:      
 
Domain Number 2 Region: 181-240
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000244
Family B-box zinc-binding domain 0.0036
Further Details:      
 
Weak hits

Sequence:  FBpp0289361
Domain Number - Region: 123-163
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00604
Family B-box zinc-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289361   Gene: FBgn0259745   Transcript: FBtr0300084
Sequence length 832
Comment type=protein; loc=2R:complement(3370899..3371069,3371152..3371304,3371367..3373320,3373390..3373610); ID=FBpp0289361; name=wech-PE; parent=FBgn0259745,FBtr0300084; dbxref=FlyBase:FBpp0289361,FlyBase_Annotation_IDs:CG42396-PE,REFSEQ:NP_001137615,GB_protein:ACL83069; MD5=12054328bfeaaa398213d13a5976da9e; length=832; release=r5.30; species=Dmel;
Sequence
MMELLSNNSVPQQMASSNAPSANNVAHSSTANGSGGGSVSSNASNSSERLLAGILESFPA
WDLNVGLLPNVGQSSPPRADFFINNFLGGLDTHGDFSIGPIGSGARSNPKMSPESSNNSS
ISCGWCEVSASIRCLECNEFMCNDCLREHRNSPLSSNHSIVSLPTPIGASPTGGSSVNAQ
TPPSGNFICDIHNEMLRYVCDYCRKLVCQCCTLHEHKEHSYASIQSFMVGSKEKLEGAIE
SSQVGTRCIKSSIDKALAFIRLIERNCSELSDNIRKAFRQFIIAIEDRERFLLDFVEKLR
QRRLAILHDQMAGLKSALAGLSETSDMLSKVADNACNMDQIEIAMKLTNGQRQMEQFAGI
YKDLQPKQEVFAFAPPDYSLLQDIRNQGGVILVDDKNLPIVSSSNGIVPSVSSVNAVAAA
SVGVVGGVAGVVGGVGVSNGLDLAFGMNMPNNPLSVASSSVRRPLLRDNSFRIPSPIMQP
RGGSACGMSSGMSSAALDWELNGLRSSPGLHFSAPRTTQAIPGCMDLVKVRNSNALSLSF
ATEGHEDGQVSRPWGLCVDKMGHVLVSDRRNNRVQVFNPDGSLKFKFGRKGVGNGEFDLP
AGICVDVDNRIIVVDKDNHRVQIFTASGVFLLKFGSYGKEYGQFQYPWDVAVNSRRQIVV
TDSRNHRIQQFDSEGRFIRQIVFDNHGQTKGIASPRGVCYTPTGNIIVSDFDNHCLYLID
PDINDILSVKGHEGSGFHEFNRPSGLCCDDEGRIIVADSKNQRILVFNQNLDFMWDIEVR
PSINPLMPPTLDEKDRTCDVAIMPDGRIVFLIELSPDSKEGSNPYKRFVHVF
Download sequence
Identical sequences Q9V4M2
FBpp0289357 FBpp0289358 FBpp0289359 FBpp0289360 FBpp0289361 NP_001137614.1.81976 NP_001137615.1.81976 NP_524772.2.81976 NP_724567.1.81976 NP_724568.1.81976 FBpp0289357 FBpp0289357 FBpp0289358 FBpp0289359 FBpp0289360 FBpp0289361 7227.FBpp0289360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]