SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289694 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289694
Domain Number 1 Region: 343-434
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.79e-40
Family Small-conductance potassium channel 0.0000104
Further Details:      
 
Domain Number 2 Region: 214-385
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.11e-26
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Weak hits

Sequence:  FBpp0289694
Domain Number - Region: 434-472
Classification Level Classification E-value
Superfamily Prefoldin 0.0107
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289694   Gene: FBgn0029761   Transcript: FBtr0300467
Sequence length 524
Comment type=protein; loc=X:join(5270120..5270226,5272335..5272554,5272663..5272764,5277096..5277412,5277575..5277679,5288086..5288221,5290217..5290327,5290506..5290633,5292098..5292167,5292437..5292538,5292623..5292795,5293727..5293730); ID=FBpp0289694; name=SK-PH; parent=FBgn0029761,FBtr0300467; dbxref=REFSEQ:NP_726989,GB_protein:AAF46027,FlyBase:FBpp0289694,FlyBase_Annotation_IDs:CG10706-PH,FlyMine:FBpp0289694,modMine:FBpp0289694; MD5=354488e71108dc547b4b505bb5953454; length=524; release=r5.30; species=Dmel;
Sequence
MKTPSIANREQISSGCNEEAAEALVGIHSDYPRYEMYMEERALTGGNTSRKPSTNSAKHK
PNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTL
ISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPG
EYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGA
LNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLI
AITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMD
TQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKL
MDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCL
TQHQERIEQRRNFLHPDTAAVAPIQAPTPQSMFNAAPMLFPHSS
Download sequence
Identical sequences A0A0Q5T2T3
FBpp0289694 NP_726989.3.81976 XP_015011003.1.56816 XP_016038170.1.80810 FBpp0289694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]