SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289789 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289789
Domain Number 1 Region: 28-189
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-46
Family Dual specificity phosphatase-like 0.00000144
Further Details:      
 
Domain Number 2 Region: 180-335
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.85e-32
Family PLC-like (P variant) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289789   Gene: FBgn0026379   Transcript: FBtr0300562
Sequence length 514
Comment type=protein; loc=2L:complement(10256487..10256506,10257395..10257716,10257778..10257993,10258064..10258173,10258235..10258397,10258549..10258656,10258728..10258915,10259029..10259173,10259241..10259413,10259476..10259575); ID=FBpp0289789; name=Pten-PG; parent=FBgn0026379,FBtr0300562; dbxref=REFSEQ:NP_001162933,GB_protein:ACZ94222,FlyBase:FBpp0289789,FlyBase_Annotation_IDs:CG5671-PG; MD5=891ccabe93b3b3f4ec62ef9c6f148510; length=514; release=r5.30; species=Dmel;
Sequence
MANTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLED
VFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWL
KEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQR
RYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGMVECSISVLHDSATENAKPDRL
KTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKSPDKIICHFWLNTFFVRNYSPCESDGTV
NKYIHTLSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSNDVQAEASEKERNENVLNFE
RSDYDSLSPNCYAEKKVLTAIVNDNTTKSQTIETLDHKDIVTKIQYDTSTNSKNTSTACK
RKQPNSKTLLPSLNDSTKEEIKRNHIFNQPSIKKTDLIKWQNSEVHITSDTRSINENKNI
NYNSYITCKQSSPKFNCGTEDGEEDWESGESTYL
Download sequence
Identical sequences Q7KMQ6
FBpp0088839 FBpp0088843 FBpp0289789 FBpp0290736 FBpp0088839 NP_001162933.1.81976 NP_477422.2.81976 NP_477423.1.81976 NP_599149.1.81976 7227.FBpp0088839 FBpp0088839 FBpp0088843 FBpp0289789 FBpp0290736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]