The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0290615 |
| Domain Number 1 |
Region: 137-260 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Eukaryotic type KH-domain (KH-domain type I) |
1.25e-35 |
| Family |
Eukaryotic type KH-domain (KH-domain type I) |
0.00000101 |
| Further Details: |
|
| |
| Sequence: |
FBpp0290615 |
| Domain Number - |
Region: 11-78 |
| Classification Level |
Classification |
E-value |
| Superfamily |
beta-sandwich domain of Sec23/24 |
0.000523 |
| Family |
beta-sandwich domain of Sec23/24 |
0.026 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Biological Process |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0290615 Gene: FBgn0017397 Transcript: FBtr0301401 |
| Sequence length |
405 |
| Comment |
type=protein; loc=3R:join(17868786..17869101,17888447..17888580,17894833..17894949,17896529..17896669,17897055..17897151,17897461..17897763,17900171..17900280); ID=FBpp0290615; name=how-PD; parent=FBgn0017397,FBtr0301401; dbxref=REFSEQ:NP_001163683,GB_protein:ACZ94979,FlyBase:FBpp0290615,FlyBase_Annotation_IDs:CG10293-PD; MD5=f720e42fddf465a84a2e50f0cbe514a4; length=405; release=r5.30; species=Dmel; |
| Sequence |
MSVCESKAVVQQQLQQHLQQQAAAAVVAVAQQQQAQAQAQAQAQAQQQQQAPQVVVPMTP
QHLTPQQQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGV
KKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRG
KGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEG
EDELKKRQLMELAIINGTYRDTTAKSVAVCDEEWRRLVAASDSRLLTSTGLPGLAAQIRA
PAAAPLGAPLILNPRMTVPTTAASILSAQAAPTAAFDQTGHGMIFAPYDYANYAALAGNP
LLTEYADHSVGAIKQQRRLATNREHPYQRATVGVPAKPAGFIEIQ
|
| Download sequence |
 |
| Identical sequences |
B3DNL7 O01367
NP_001163683.1.81976 NP_524447.2.81976 FBpp0083575 FBpp0083575 FBpp0290615 7227.FBpp0083575 FBpp0083575 FBpp0290615 |
