SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290837 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290837
Domain Number 1 Region: 1454-1583
Classification Level Classification E-value
Superfamily Bromodomain 7.06e-31
Family Bromodomain 0.0000102
Further Details:      
 
Domain Number 2 Region: 1597-1696
Classification Level Classification E-value
Superfamily Bromodomain 7.06e-30
Family Bromodomain 0.00011
Further Details:      
 
Domain Number 3 Region: 12-76
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 1.18e-20
Family TAF(II)230 TBP-binding fragment 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290837   Gene: FBgn0010355   Transcript: FBtr0301622
Sequence length 2096
Comment type=protein; loc=3R:join(2472712..2472893,2473016..2473323,2473516..2473650,2473705..2473916,2473982..2474607,2474667..2475047,2475103..2475817,2475875..2476147,2476221..2476442,2476513..2478400,2478472..2478614,2478682..2479012,2480192..2480386,2480711..2480803,2480931..2481517); ID=FBpp0290837; name=Taf1-PD; parent=FBgn0010355,FBtr0301622; dbxref=REFSEQ:NP_001163532,GB_protein:ACZ94830,FlyBase:FBpp0290837,FlyBase_Annotation_IDs:CG17603-PD,FlyMine:FBpp0290837,modMine:FBpp0290837; MD5=08abf8206698ec6ba67cc1da04a03646; length=2096; release=r5.30; species=Dmel;
Sequence
MEMESDNSDDEGSIGNGLDLTGILFGNIDSEGRLLQDDDGEGRGGTGFDAELRENIGSLS
KLGLDSMLLEVIDLKEAEPPSDDEEEEDARPSAVSASEGMSAFDALKAGVKREDGAVKAQ
DDAIDYSDITELSEDCPRTPPEETSTYDDLEDAIPASKVEAKLTKDDKELMPPPSAPMRS
GSGGGIEEPAKSNDASSPSDDSKSTDSKDADRKLDTPLADILPSKYQNVDVRELFPDFRP
QKVLRFSRLFGPGKPTSLPQIWRHVRKRRRKRNQSRDQKTTNTGGSDSPSDTEEPRKRGF
SLHYAAEPTPAECMSDDEDKLLGDFNSEDVRPEGPDNGENSDQKPKVADWRFGPAQIWYD
MLEVPDSGEGFNYGFKTKAASTSSQPQLKDERRVKSPEDDVEDPSIADDAFLMVSQLHWE
DDVVWDGNDIKAKVLQKLNSKTNAAGWLPSSGSRTAGAFSQPGKPSMPVGSGSSKQGSGA
SSKKAQQNAQAKPAEAPDDTWYSLFPVENEELIYYKWEDEVIWDAQQVSKVPKPKVLTLD
PNDENIILGIPDDIDPSKINKSTGPPPKIKIPHPHVKKSKILLGKAGVINVLAEDTPPPP
PKSPDRDPFNISNDTYYTPKTEPTLRLKVGGNLIQHSTPVVELRAPFVPTHMGPMKLRAF
HRPPLKKYSHGPMAQSIPHPVFPLLKTIAKKAKQREVERIASGGGDVFFMRNPEDLSGRD
GDIVLAEFCEEHPPLINQVGMCSKIKNYYKRKAEKDSGPQDFVYGEVAFAHTSPFLGILH
PGQCIQAIENNMYRAPIYPHKMAHNDFLVIRTRNNYWIRSVNSIYTVGQECPLYEVPGPN
SKRANNFTRDFLQVFIYRLFWKSRDNPRRIRMDDIKQAFPAHSESSIRKRLKQCADFKRT
GMDSNWWVIKPEFRLPSEEEIRAMVSPEQCCAYFSMIAAEQRLKDAGYGEKFLFAPQEDD
DEEAQLKLDDEVKVAPWNTTRAYIQAMRGKCLLQLSGPADPTGCGEGFSYVRVPNKPTQT
KEEQESQPKRSVTGTDADLRRLPLQRAKELLRQFKVPEEEIKKLSRWEVIDVVRTLSTEK
AKAGEEGMDKFSRGNRFSIAEHQERYKEECQRIFDLQNRVLASSEVLSTDEAESSASEES
DLEELGKNLENMLSNKKTSTQLSREREELERQELLRQLDEEHGGPSGSGGAKGAKGKDDP
GQQMLATNNQGRILRITRTFRGNDGKEYTRVETVRRQPVIDAYIKIRTTKDEQFIKQFAT
LDEQQKEEMKREKRRIQEQLRRIKRNQERERLAQLAQNQKLQPGGMPTSLGDPKSSGGHS
HKERDSGYKEVSPSRKKFKLKPDLKLKCGACGQVGHMRTNKACPLYSGMQSSLSQSNPSL
ADDFDEQSEKEMTMDDDDLVNVDGTKVTLSSKILKRHGGDDGKRRSGSSSGFTLKVPRDA
MGKKKRRVGGDLHCDYLQRHNKTANRRRTDPVVVLSSILEIIHNELRSMPDVSPFLFPVS
AKKVPDYYRVVTKPMDLQTMREYIRQRRYTSREMFLEDLKQIVDNSLIYNGPQSAYTLAA
QRMFSSCFELLAEREDKLMRLEKAINPLLDDDDQVALSFIFDKLHSQIKQLPESWPFLKP
VNKKQVKDYYTVIKRPMDLETIGKNIEAHRYHSRAEYLADIELIATNCEQYNGSDTRYTK
FSKKILEYAQTQLIEFSEHCGQLENNIAKTQERARENAPEFDEAWGNDDYNFDRGSRASS
PGDDYIDVEGHGGHASSSNSIHRSMGAEAGSSHTAPAVRKPAPPGPGEVKRGRGRPRKQR
DPVEEDLQCSTDDEDDDEEEDFQEVSEDENNAASILDQGERINAPADAMDGMFDPKNIKT
EIDLEAHQMAEEPIGEDDSQQVAEAMVQLSGVGGYYAQQQQDESMDVDPNYDPSDFLAMH
KQRQSLGEPSSLQGAFTNFLSHEQDDNGPYNPAEASTSAASGADLGMDASMAMQMAPEMP
VNTMNNGMGIDDDLDISESDEEDDGSRVRIKKEVFDDGDYALQHQQMGQAASQSQIYMVD
SSNEPTTLDYQQPPQLDFQQVQEMEQLQHQVMPPMQSEQLQQQQTPQGDNDYAWTF
Download sequence
Identical sequences E1JJ72
NP_001163532.1.81976 FBpp0290837 FBpp0290837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]