SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290895 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290895
Domain Number 1 Region: 491-841
Classification Level Classification E-value
Superfamily TPR-like 1.34e-37
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290895   Gene: FBgn0051690   Transcript: FBtr0301681
Sequence length 849
Comment type=protein; loc=2L:join(2704927..2705036,2710499..2711916,2712022..2712136,2718294..2718774,2718840..2718924,2719002..2719342); ID=FBpp0290895; name=CG31690-PD; parent=FBgn0051690,FBtr0301681; dbxref=REFSEQ:NP_722826,GB_protein:AAF51225,FlyBase:FBpp0290895,FlyBase_Annotation_IDs:CG31690-PD,FlyMine:FBpp0290895,modMine:FBpp0290895; MD5=5aa6458c53eb8ae2b660e686b841234b; length=849; release=r5.30; species=Dmel;
Sequence
MSATLSHKDLAGLAGCSALAFVLYLNTLNAGFVYDDRRAILANGDVTGARPLANLLRNDF
WGTPLVDSGSHGSWRPLCVLSFRLNYLAGGMTPLGYHLVNVMLHCVATWLVFLVARTLLP
SRMGVLAAGALFAVHPAHTEAVAGLVGRADLASCVCYLLAYLSYRRHMLNREWGSLILTI
MLALAALLCKETAITALLLCGLCDVLSPVGRENSDKVCDGSISGLASFNFQRRFRSLSIL
GFTLLCGLYCRLSLLPRPSTAFSAADNPTAHESCFWTRTLTFLYLPVANFGILLWPQELS
FDWGMEAVSRIRTLWDARNILTAGFYGSLVAILWKGSGLRSAASPMDFAEVANISLPLLR
RLGGNSCHTWLGLTCDCHHQLSAPSYRSASAIYSTSSKSKSASWTAAPILGTAFLVLPFL
PASNLLFYVGFVMAERVLYLPSVGYCLLFGLGFGHLWQRVNSSWRSRLMLLCGLALLLGV
HGVRTFRRNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELTLRMTLGHRPT
MADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQEAISVL
RTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLKALPLLPQKQR
AVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTLARNGSRLAEAESWFK
RALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQSCVADALRLLNRL
AEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPGHAISRANLAR
MNVHKHENE
Download sequence
Identical sequences FBpp0290895 FBpp0290895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]