SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291164 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291164
Domain Number 1 Region: 341-432
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.44e-40
Family Small-conductance potassium channel 0.0000104
Further Details:      
 
Domain Number 2 Region: 212-383
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-26
Family Voltage-gated potassium channels 0.003
Further Details:      
 
Weak hits

Sequence:  FBpp0291164
Domain Number - Region: 432-470
Classification Level Classification E-value
Superfamily Prefoldin 0.0123
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291164   Gene: FBgn0029761   Transcript: FBtr0301952
Sequence length 576
Comment type=protein; loc=X:join(5270120..5270226,5272335..5272554,5272663..5272758,5277096..5277412,5277575..5277679,5282275..5282410,5290217..5290327,5290506..5290633,5292098..5292167,5292437..5292538,5292623..5292795,5293565..5293730); ID=FBpp0291164; name=SK-PL; parent=FBgn0029761,FBtr0301952; dbxref=REFSEQ:NP_525078,GB_protein:AAF46030,FlyBase:FBpp0291164,FlyBase_Annotation_IDs:CG10706-PL,FlyMine:FBpp0291164,modMine:FBpp0291164; MD5=440018414fec79b711e5b10d92e014b5; length=576; release=r5.30; species=Dmel;
Sequence
MKTPSIANREQISSGCNEEAAEALVGIHSDYPRYEMYMEERALTGGNTSRKPSTNSAKHK
PNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTL
ISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEY
YFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALN
RINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAI
TFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQ
LTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMD
NANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQ
HQERIEQRRNFLHPDTAAVAPIQAPTPQSMFNAAPMLFPHSRSVPSSNNAAATYHWPTSP
ILPPISSRTPHLVPDTHMPSNGSAVNSYASSNKYGS
Download sequence
Identical sequences A0A0Q5T320
FBpp0291164 NP_525078.3.81976 XP_015011004.1.56816 XP_016038159.1.80810 XP_016923117.1.48971 FBpp0291164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]