SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291165 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291165
Domain Number 1 Region: 746-837
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 8.76e-40
Family Small-conductance potassium channel 0.0000104
Further Details:      
 
Domain Number 2 Region: 617-788
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-25
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291165   Gene: FBgn0029761   Transcript: FBtr0301953
Sequence length 927
Comment type=protein; loc=X:join(5245862..5247037,5270081..5270226,5272335..5272554,5272663..5272758,5277096..5277412,5277575..5277679,5288086..5288221,5290217..5290327,5290506..5290633,5292098..5292167,5292437..5292538,5292623..5292795,5293727..5293730); ID=FBpp0291165; name=SK-PM; parent=FBgn0029761,FBtr0301953; dbxref=REFSEQ:NP_996354,GB_protein:AAS65264,FlyBase:FBpp0291165,FlyBase_Annotation_IDs:CG10706-PM,FlyMine:FBpp0291165,modMine:FBpp0291165; MD5=9fafe13bf6ba1e8c3ff41a0eeb902dc8; length=927; release=r5.30; species=Dmel;
Sequence
MSIQKLNDTTNSGYVSSEETDSLLVSSSNPSKGGGRTALLRQVKSNSTNGPTTGASTSSS
GSVSGGGGGSGSGGGSASGSAAGASKPTLMRQDRTSTYLTSPQQSQHARMGSEESMRGGA
SGAAGHDEDVEQGLVRSSIVPDIEVHEEDQEQHSQQLNATTMATMTNNQQQQQPTISIMN
LSLKPGDSHSHSSSPGSHPNLGTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLID
RSASRDSVKSAFQQGNLSGSMAICISNSALPQQQQLQQQYHLQQQQQQHYQLQQHHLHQQ
QLQQSQQQVPPVLITSSPTNGSRIIRQSSQPESSSTAICCGPHSACVGHAHSHSHTVPNV
SLKQLRESSGDGIAGIAADSLRINGGMRPFKQLRKPASTLSIPGSMKTPSIANREQISSG
CNEEAAEALVGIHSDYPRYEMYMEERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFE
KRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAY
HALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTI
GTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMT
ICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTY
CGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRE
TWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTV
YEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHPD
TAAVAPIQAPTPQSMFNAAPMLFPHSS
Download sequence
Identical sequences NP_996354.2.81976 FBpp0291163 FBpp0291165 FBpp0291165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]