SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291166 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291166
Domain Number 1 Region: 504-595
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 5.75e-40
Family Small-conductance potassium channel 0.0000104
Further Details:      
 
Domain Number 2 Region: 375-546
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-26
Family Voltage-gated potassium channels 0.003
Further Details:      
 
Weak hits

Sequence:  FBpp0291166
Domain Number - Region: 595-633
Classification Level Classification E-value
Superfamily Prefoldin 0.018
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291166   Gene: FBgn0029761   Transcript: FBtr0301954
Sequence length 685
Comment type=protein; loc=X:join(5252305..5252754,5270081..5270226,5272335..5272554,5272663..5272758,5277096..5277412,5277575..5277679,5282275..5282410,5290217..5290327,5290506..5290633,5292098..5292167,5292437..5292538,5292623..5292795,5293727..5293730); ID=FBpp0291166; name=SK-PN; parent=FBgn0029761,FBtr0301954; dbxref=REFSEQ:NP_001096885,GB_protein:ABX11900,FlyBase:FBpp0291166,FlyBase_Annotation_IDs:CG10706-PN,FlyMine:FBpp0291166,modMine:FBpp0291166; MD5=4a88af647e167a4ea5761387acca1cb1; length=685; release=r5.30; species=Dmel;
Sequence
MSPAFCMDNDCNQSALYQKCHATPPPPPMPPMPVIPPLPPMPVIPPIPPLPPMVVSTSST
PSATPSMTPSPTPSRSPSLTVMMTSPQALQSLQPQVPQTQMSQPVNTAAALMTRTGSVGG
ATSAARRNSLWLETLRSTRKLSYANERPILLRKPASTLSIPGSMKTPSIANREQISSGCN
EEAAEALVGIHSDYPRYEMYMEERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKR
KRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHA
LEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGT
EMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTIC
PGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCG
RGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETW
LIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYE
IISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHPDTA
AVAPIQAPTPQSMFNAAPMLFPHSS
Download sequence
Identical sequences FBpp0291166 FBpp0291166 NP_001096885.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]