SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291240 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291240
Domain Number 1 Region: 177-220
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000377
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291240   Gene: FBgn0032660   Transcript: FBtr0302030
Sequence length 229
Comment type=protein; loc=2L:complement(18010497..18010865,18010934..18011011,18011078..18011206,18011263..18011376); ID=FBpp0291240; name=elfless-PB; parent=FBgn0032660,FBtr0302030; dbxref=REFSEQ:NP_001163003,GB_protein:ACZ94289,FlyBase:FBpp0291240,FlyBase_Annotation_IDs:CG15150-PB,FlyMine:FBpp0291240,modMine:FBpp0291240; MD5=0ddd9c7113942fdd4a90eac9ed850a2c; length=229; release=r5.30; species=Dmel;
Sequence
MGDSSDSDSSTEWEQNTRVISLPFSRNRSHLSSRLSYLVGLQMENFRTSNNSGVSQRIHN
TGPTPVLAPSGLRSRLLSGSSERNPNEYYGDSDSSSSSRSIDRTPFLLEYSSDSESSSSS
DSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKRIKSDDEESKKSVLPYNCPV
CLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLCGVDEPEFHRIFL
Download sequence
Identical sequences Q9VJB0
FBpp0291240 FBpp0291241 NP_001163003.1.81976 NP_609860.2.81976 FBpp0291240 FBpp0291240 FBpp0291241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]