SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291381 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291381
Domain Number 1 Region: 529-658
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-18
Family Second domain of FERM 0.0016
Further Details:      
 
Weak hits

Sequence:  FBpp0291381
Domain Number - Region: 148-220
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0034
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291381   Gene: FBgn0039282   Transcript: FBtr0302171
Sequence length 828
Comment type=protein; loc=3R:join(20958317..20958675,20958738..20959489,20959552..20959718,20959774..20960120,20960185..20960346,20960414..20960602,20960669..20960798,20960872..20960970,20961030..20961180,20961248..20961378); ID=FBpp0291381; name=Bili-PF; parent=FBgn0039282,FBtr0302171; dbxref=REFSEQ:NP_001163725,GB_protein:ACZ95019,FlyBase:FBpp0291381,FlyBase_Annotation_IDs:CG11848-PF; MD5=737281db6a556966bc9707af6fdf4f9b; length=828; release=r5.30; species=Dmel;
Sequence
MEPNHYYCRSAMQQNPSTSIPQHASNKLNYGMNAGQDYVTCSSGQSQSGYSSKDLVPRSG
NSKTLGGNGNMGSPYGGSVCSNSGQCSKNTANAGNYINIMTVPLGTLQYNRKKLSTQDYE
SHLYYNTTDVKCRDDYYIANNAAAAIPQHQAHQPHQQPHQHQHPQHQQQHQQHQQHQQHQ
QHQQHLHQQQQQQANFLHIQQSLQHNHQLSHPEPIHQLPQLQGTVADPPDAFDNCAIFPS
AGGSSNGSGRVAATQTHQNPSGVVTCDQQVPVSLGSVNMPVPPIMYTVHRVVTTAQIQTA
AGSTFASSASVSSVVSTGQNDGDCLSPAQVSSAMAASGNASCLGGLPDMGANMMSNASAL
CPLSDLRSPSGVLTNSSYMPQHHKCNNGNDAQSNPAIQKRLMATSSTSNFATAGKAASNL
TRALQNVIPTCVYLMSRVAVHMEIEGTAQCPSQVMLAAALGCEELGISNKLLAQSVFGLW
MTSALLEMQLKAHHCPYIVRVAWPNLLQKFSNSSPSDRKFDEPMIVLKRNVFFSKRDEEK
IKDHRILELLYEEARNNVLTGRYIMEPVHSLMLGGIQARIELGPYNSHTHTIGFFRENQA
RFLPPHVAKSSTWLWLPISQKNSAEVKLLEQFKRVPQTATTRKLMRKYLEFCWALPFYGA
AYFHGQIEQPVRGIMALVNQKDMEVLVAVNERGVFVIDPYECTLLLGLRYEDLSWDYAKP
SASDDPECLTCIFLQFDAVENGIQVSKLMQIFSKQAAMIDALISHFTDQIRNKKQEGNTQ
EPFHDEPNPIQNNGNGVLCNKLSRLTLATFDEEGGRCIGQMGSLSISY
Download sequence
Identical sequences Q9VBX0
FBpp0290884 FBpp0291378 FBpp0291379 FBpp0291380 FBpp0291381 FBpp0291382 FBpp0290884 NP_001163722.1.81976 NP_001163723.1.81976 NP_001163724.1.81976 NP_001163725.1.81976 NP_001163726.1.81976 NP_001287521.1.81976 NP_651342.3.81976 FBpp0290884 FBpp0291378 FBpp0291379 FBpp0291380 FBpp0291381 FBpp0291382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]