SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291808 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291808
Domain Number 1 Region: 431-807
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.59e-119
Family Oxysterol-binding protein 0.0000572
Further Details:      
 
Domain Number 2 Region: 59-182
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-22
Family Pleckstrin-homology domain (PH domain) 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291808   Gene: FBgn0261550   Transcript: FBtr0302668
Sequence length 957
Comment type=protein; loc=3R:join(16143992..16144007,16144699..16144748,16145286..16145432,16145491..16145722,16145937..16146596,16147198..16147358,16147424..16147602,16147671..16148864,16148937..16149171); ID=FBpp0291808; name=CG42668-PE; parent=FBgn0261550,FBtr0302668; dbxref=FlyBase_Annotation_IDs:CG5077-PE,FlyBase:FBpp0288539,FlyBase:FBpp0291808,FlyBase_Annotation_IDs:CG42668-PE; MD5=f1e0d2250858605b40302e1d5a4bf77d; length=957; release=r5.30; species=Dmel;
Sequence
MNLLQRIANWASDNRDGNVADKSAADAAKLNRKESYKAQRKNYRREKKRVASELMNSLQD
PAVIVLADWLKVRGTLKSWTKLWCVLKPGLLLIYKSQKTKSSHWVGTVMLTSCQVIERPS
KKDGFCFKLFHPLEQSIWAPRGPDKETIGAVVQPLPTAYLIFRAPSQAAGKCWMDALELS
LRCSALLLRSNSSTGTAPTSSYIGEPLPVSHETQWSEADYEKHFNDHGKWAQFLALPSAE
VDTSRSDTSLSAPRTPTPLLQQLYTSAVSNWERTKRLPRFGHQSEQRKTSYSDASSAEQG
VGVGLSLLQRKRRHLSPMSKSMSLGATLCNSSSSEDEDEGYNHSQTGLRPVSAPPDCLMM
PRFRLNVKDLDADSQNEAPNAVMSGLESESESDPAEPAQDDVVDQQCVETSYVPFTEEEF
GEQGEQVEELAEENKSLIWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHADLL
SKAVQEDDAFTRMKLVVQWYLSSFYKKPKGLKKPYNPILGERFRCYWQHPSGSRTFYIAE
QVSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAATMTLLPRGECYTATT
PYAHCKGILMGTLSMELGGKINIECENTGYRTELEFKLKPFLGGADATNVVVGKIKLGKE
TLATINGHWDKECRVKDSKTGEETVLFKVDAETRSKRLTRYMVPLDLQEANESQRLWQRV
SEAIANEDQVAATEEKTVLEERQRADAKERLSSDSVHMPDLFELDSYGQWLYKYADLRPW
DSRNDVRQYECQFKVLTQTRHKSVPIVHGAEMIHPLRSSIETLSRTQRQSPAGQPLPPGG
SAVPKAKNKSLVLAPRDTNSDSSQSPQGAVKRSSSSAIKQLALAVDQVNRVLEQHTRQLN
EISQRLERMQYSPPPSSMSAHSLHMLGGGVSQSTVIKSLIYALIGLAFSLILRWLFK
Download sequence
Identical sequences B7Z0M9
FBpp0291808 FBpp0291808 NP_001138086.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]