SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291873 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291873
Domain Number 1 Region: 2382-2560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-33
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 1970-2148
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-27
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 3 Region: 2195-2371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-26
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 4 Region: 1775-1965
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.51e-26
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 5 Region: 1589-1761
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000116
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 6 Region: 342-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 486-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 862-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000092
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 391-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000148
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 10 Region: 918-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.033
Further Details:      
 
Weak hits

Sequence:  FBpp0291873
Domain Number - Region: 965-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family Laminin-type module 0.031
Further Details:      
 
Domain Number - Region: 439-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 552-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00865
Family Laminin-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291873   Gene: FBgn0261563   Transcript: FBtr0302733
Sequence length 2567
Comment type=protein; loc=2L:join(14308157..14309177,14319554..14320913,14320989..14321244,14321309..14321705,14321791..14323478,14323536..14324288,14324349..14324631,14324688..14324838,14324897..14325554,14326435..14327053,14327110..14327243,14327301..14327529,14327597..14327751); ID=FBpp0291873; name=wb-PD; parent=FBgn0261563,FBtr0302733; dbxref=FlyBase:FBpp0291873,FlyBase_Annotation_IDs:CG42677-PD; MD5=61c9b5363d1a4d386f9293d455180ada; length=2567; release=r5.30; species=Dmel;
Sequence
MSASDKRTVKMSDASIKPRKLKKHLRAADVKPRGMMTKSLLLHLCVYLVCITQTLQLQQR
QQQQQQQHRQQQHGQPEGNMLQQHHRTSVNSSVNINISRQFNEIIQTATASASASGTGSA
SGAVTFASVTAATTITPGRRKLRRKFQGQQNRNSTLGRRRKLRLHPYHRRNATHATRTTT
VASVSATATTLLPKMPHKQPFNYHTHLHSSFQQQQQQQHVAGGQVTQQQQQQQQVHVVAV
TPRPQQRQQQPGFAIVPATYYHQQQQQQQRTLLGNLTQQQQQQQQHLLIQPGQNILVYSN
LGPIPPCPPGLLSGSGMPVYTQQQHFIPLRSTTTPRPRQRECHCSSVGSLSSDCDKRTGQ
CACLANVTGRRCDKCRPGHWNLTAGEGCRDCRCDPHGSRGHECNPWTGQCDCKIGVGGQH
CNECTEGFFGFSTEGCQRCSACRSEGQVCDPHNGRCICPKFTRGLGCGQCVPGTWGWQAR
LGCRECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPECRRCGCDAEGSF
TQADGSIACDSNGQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFCFGRSGECEQSD
LSWGHIRMAESRNLSVQQIRPHSVPSSDYEYIVVVQMEGSSFHREDAEIQRMNDLSLVPK
STGNVSIGAYGQFYHPLYFQLPPQFYGDRTSSYGGFLYFTLITEGAHKPLERNILGQYPL
VQLHAHSKLLLDFYEYEEFEYSLNVTHRVPLHESFWKYHHTSQAVDRNTLMAALQNIRHI
FIRAFAFADFQEVVLQNVHMDAAIYIKGSTNLIAKGVERCKCPKRFDGLSCQDPGRSFYR
WRNTTIVESVFIEDLIGRAAPCHCNGRSSDCDRETGVCQNCRGNTGGDHCHQCAEGFYGD
PNSPHGCQACPCPETNRNFARGCNVWDGEVSCVCKPGYTGRLCERCQAGYFGDPMRYPNT
TCQPCNCHPDGIQTEGCDVETGRCYCREGVTGLKCDKCQAERHHLVDNGCKICDNCTLLL
LDYMELVGNKLRRGMHNMDLTGIPAPYRKLSEYESAYEKWNGRHWDFSQTKRRLQDYDSA
DILKLEAHAENLKFQSRKAVATIGKREFAIKSMREDAVTQQHSVGLLRSEILQTLSDLHG
YGKSAHYLSLPTALKQARFYLQAIREHDQMVQGIRSTNDCAWKHFYAMGNASDASFDESG
RLEMLWRDLNQTNHRVVDMRLQVDRVQEVENEAEDVLEHVRNLSIRVGESHQELDELNQR
ISDHLDPGYLEQGEGLLRLTVQRQIMLNGHLNQLDGYRILLNTTLGVKTEQQREVRKHWL
PKAEKHASHLLARSNEYARKFQPTRNGARIAMLASSAHSNITEAINDARLASILAKERVY
EAQRTLYPSDGSSMIERAKHSLHRSKQLQQEALKQMHKSNVLKDKLHRQEQQVEGIKSTI
YDSGLRTNNISGQLQGLSDGSARRQAKDSLEMADRTGEQMRAELQKAKDMQKSIQNMRNS
FSNLEPDWEIKLGMAQENISLTQTNLRLANVSLSYLEQQAEKEQQVFEVWNNSMAQQLQQ
LRDQIAKARHAAEAIDVSLESLGPKCIRSYLPASYGLSTSNKIRMSFALSNHLESSPLIH
LASSEGRHITLELYKRRVRLVWNLGGTTATVTHPMVVHTRDPKYDDAWYHVEANRTLNLG
SLVVRRMNNYGELTPPNPVIITGSTDTEHTRFYQSRSDRISLGGFASKDLQFTPGLNVVV
HQVEVDNKPLGLWNFVTSEGSCGGSMVGAKESSASSTARHFNGLGYAQLMKTRPRPTRKN
LFSVQMTFRTLDENALLFLAVDDKNNRSVSVTLSRGRIMFRIDYGDESKLEINTTKKYNV
GQWIKIEAAREFSAKRSTENGMLRVNNDRPISGAPTLPVNIHLLPDLSKTVYYLGGVPPG
FTSGTSKAPGADNPFLGCMKDVQVNGETYDPLESSSYYGVEPSCKNMITKAGFSGNGYLE
LPSQSLRKRSNTALVFRTLQPDCLLLLAAYPPEILGDYDAKDIKGNFSISLVDGQLHVWV
NSGRSFIKMSSNSSQMNDGEFHVVHLIKTGRKLELMVDDELQEIRNLNGNPTVVSLPRDA
GGLYIGGAPPHESYTPLAPTFVNLEGAIRDVVFNNRTINFNDALTFANVQIGRNGPLMGS
LKGGLYDVLLKTEPMIGKSFTASPEGCKRIGSYSYEPNAFKFGDDIYSYSQLKLPERHFW
QRNFHLSFDFRSFYPNGMLYLSPGSKEKPKHYVALVLKDGQLVLVVRGRRREELQLTAKL
NDGEWHRVTISCHDRKVTMSVEIGRTDQKTSAQMKLPKKIGASQLLLVGGLPQSPVKVSS
DLYVRLEPFKGCLRRVSINNNTQDLARPGKHSNVGQCFPTVERGSYFPGDAYAIYKKNFN
VGKYLDLETEFRTSELSGILLSVSDPNGFPALSLELHNGNIIFSCDPGNGAPMRVESSLP
TKYALCDNKWHNISALYDGEQIVLRIDQLPAVISVGNQGNAGKVQTRSPLYIGGLPESAP
SGSLISRENFKGCIRHVSIRNERRDWIEMEDLRNVLLSECLVSSDES
Download sequence
Identical sequences M9MRU0
FBpp0291872 FBpp0291873 FBpp0291874 FBpp0291875 NP_001188806.1.81976 NP_001188807.1.81976 NP_001188808.1.81976 NP_001188809.1.81976 FBpp0291872 FBpp0291873 FBpp0291874 FBpp0291875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]