SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292349 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292349
Domain Number 1 Region: 334-357
Classification Level Classification E-value
Superfamily DPY module 0.0000262
Family DPY module 0.0022
Further Details:      
 
Weak hits

Sequence:  FBpp0292349
Domain Number - Region: 66-89
Classification Level Classification E-value
Superfamily DPY module 0.00876
Family DPY module 0.0046
Further Details:      
 
Domain Number - Region: 289-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 28-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0377
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292349   Gene: FBgn0031089   Transcript: FBtr0303257
Sequence length 403
Comment type=protein; loc=X:join(20042292..20042294,20044098..20044158,20044631..20044869,20044978..20045059,20048231..20048847,20049132..20049341); ID=FBpp0292349; name=CG9572-PC; parent=FBgn0031089,FBtr0303257; dbxref=FlyBase:FBpp0292349,FlyBase_Annotation_IDs:CG9572-PC; MD5=80b33f1b82c66e26fa55248c138f5de6; length=403; release=r5.30; species=Dmel;
Sequence
MQLLVVALVAVAIASLPQLAAAQSYASGCSGSPCGVNAVCQEASGGRPVCSCPPGFSGNP
LTHCNRGECLDNVDCRDNLQCKDNRCVNPCVGACGIGSNCDARNHVAVCSCPAGYNGDPY
HACHLNDPEEQCHPSPCGVNTKCEIINGVPTCSCVHGYVGNPLSGCRHECDHDGDCSSRD
MCSSNFKCVPACGQCGTGATCRTVSNHRAVCECPKGYIGSPYTECRPECYGDADCPAGRP
ACFYGICKNTCEGACGIGADCNLRGLTPVCSCPRDMTGDPFVRCRPFTKEDLCDPNPCGT
NAICVPGHDNTGRERPVCNCLPGHTGNPLSHCTRGECLSNNECPDHRACINYQCIDPCIG
KCATGASCEPKAHLAVCRCPQGQSGDALVSCRQTRTFPVAKYH
Download sequence
Identical sequences FBpp0292349 FBpp0292349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]