SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292843 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292843
Domain Number 1 Region: 990-1221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-37
Family Laminin G-like module 0.0084
Further Details:      
 
Domain Number 2 Region: 1248-1455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-34
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 3 Region: 473-597
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.00099
Further Details:      
 
Domain Number 4 Region: 30-136
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-23
Family Cadherin 0.00093
Further Details:      
 
Domain Number 5 Region: 245-356
Classification Level Classification E-value
Superfamily Cadherin-like 5e-22
Family Cadherin 0.00026
Further Details:      
 
Domain Number 6 Region: 130-252
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-19
Family Cadherin 0.00063
Further Details:      
 
Domain Number 7 Region: 583-699
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.0014
Further Details:      
 
Domain Number 8 Region: 358-485
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000314
Family Cadherin 0.0034
Further Details:      
 
Domain Number 9 Region: 700-800
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000514
Family Cadherin 0.0099
Further Details:      
 
Domain Number 10 Region: 1498-1537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000695
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1459-1515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000726
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292843   Gene: FBgn0262018   Transcript: FBtr0303836
Sequence length 1799
Comment type=protein; loc=2L:complement(17788305..17788624,17789083..17789256,17789335..17789556,17794473..17794714,17796753..17796923,17797348..17799673,17801697..17802605,17803077..17803497,17806368..17806505,17809238..17809402,17810823..17810938,17815574..17815717,17827421..17827472); ID=FBpp0292843; name=CadN2-PC; parent=FBgn0262018,FBtr0303836; dbxref=FlyBase:FBpp0292843,FlyBase_Annotation_IDs:CG42829-PC; MD5=93daeef3080212561368ae4dbcc4243f; length=1799; release=r5.30; species=Dmel;
Sequence
MVDPLKIFWVLTNSTYLVTKFVRIGIADKNDSPPYFDRFLYETEIDENADLQSTVLTVNA
KDHNESTNIRYQITGGNIGNAFAVQNTTGVIYVASPLDYETRPRYELRLEATRNRKNNYT
TVVINVRDVNDNPPVFDRQTYRTQITEEDDRNLPKRILQVTATDGDVDRPINIVYFLTGQ
GIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQV
NLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIE
EETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIRVKDLNDM
PPQFTKDEWVTEVDETNGTYIPETPILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRN
GDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDIND
NVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRG
AVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYKPTLPE
NVSGKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIIS
SLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIGDVNDNKMQPGSKSVLVYNYQGQ
SQDTPIGRVYVNDPDDWDVPDKKYYWEVQEHQRFKLDTDTGILTMRAGTRRGRYQLRFKV
YDREHGQEDIPANLSVTVRDITAEAVQQAGSMRLSHITDEDFVRTWNPVKNQVEPSKLER
FRNKLAELLYTDRDNVDVFSVQLKEGSPYPLTDVHFAARSATQQPYFKAVRLNGVVQMHR
EEIEKDVGLNITMVNINECLHEGKGKCGSNSCTSKVELGKKPYTVSVNRTALVGVRLDIS
AQCVCRARNFTHQDHNCRTHLCYNGGRCVETRNGPKCVACPVGYNGPRCQQSTRSFRGNG
WAWYPPLQLCQESHLSLEFITRVADGLILYNGPIVPPKPEETVISDFIALELEQGYPRLL
IDFGSGTLELRVKTKKTLDDGVWHRLDIFWDTENVRMVVDFCRTALVSEMEDGTPPEFDD
NACQARGQIPPFAESLNLNQPLQLGGLYRQHFDQTLYNWQYAFSSKGFDGCIRNVIHNSE
HYDLAFPALARNSFPACPQTDEVCLKTEHTARCWEHGNCVASLVQAKCHCQPGWMGPGCN
VPTIPTTFKAQSYVKFALSFEPDRFSTQLQLRFRTREQGGELFRVSDQHHREYAILELRR
GHLQFRYNLNSMRNEEQLLTLTAIAVNDGQWHVIRISRYGSAALMELDGGESRRYNESFH
FTGHQWLTIDKQEGVYAGGKAEYTGIKTFEVQSDFQRSCLDDIRLDGKHLPLPPAMNGTQ
WGQATMARNLERNCPSNRPCSNVICPDPFDCVDLWNEYECTCSEGRIMSSDTKGCVDRNE
CLDLPCLNGATCINLEPRLRYRCICPEGYWGENCELVQEGQRLKLSMGALGAIFVCLIII
LILALIFVLYSRKRKTTKKKKRSGPEKDVRETVISYEDEGGGEDDMTAFDITPLQIPISA
QGGPPDIAACKMPIIYPVMTLLPPGQELNVAYLMEERKQRIDKDNNAPPFDDLRNFTFEG
SGSIAESLSSLASGTDDENQDFNYLQNWGPRFNALAAMYVHDKAKASSQLPSDGGGGSGD
GPGPGASSSSPLGGGGTGGGSGIPGNVLAVVATGSGAGPGGGGGSSGLMPLPEVDKVVL
Download sequence
Identical sequences Q9VJB6
NP_001036368.2.81976 NP_609855.3.81976 FBpp0292843 FBpp0292843 FBpp0292843 FBpp0300935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]