SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0277769 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0277769
Domain Number - Region: 29-102
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00319
Family C-type lysozyme 0.034
Further Details:      
 
Domain Number - Region: 97-127
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00549
Family Type I dockerin domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0277769   Gene: FBgn0079580   Transcript: FBtr0279331
Sequence length 161
Comment type=protein; loc=3:join(6702547..6702628,6704196..6704366,6704430..6704662); ID=FBpp0277769; name=Dpse\GA19584-PA; parent=FBgn0079580,FBtr0279331; dbxref=FlyBase:FBpp0277769,FlyBase_Annotation_IDs:GA19584-PA,GB_protein:EAL25354,REFSEQ:XP_001360779,FlyMine:FBpp0277769; MD5=7f63e492ddc817dfd73eb24c0f2e0aef; length=161; release=r2.13; species=Dpse;
Sequence
MAANKLCCTLVFGALLCLGLVALIQAQDKPVTDVCLGCICEAISGCNQTRFCGGGVCGLF
RITWAYWSDGGKLTLGNESPQSEDAYANCVNDPYCAANTIQNYMTKFGQDCNKDGGIDCY
DYAAIHKLGGYGCGGELAYQYQTSLQSCLNSFQQLDVRSGP
Download sequence
Identical sequences B4GBP6 Q290K8
FBpp0175671 XP_001360779.2.19638 XP_002016414.1.64850 XP_017150036.1.22881 FBpp0277769 7237.FBpp0277769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]