SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0277828 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0277828
Domain Number 1 Region: 55-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 9-54
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0277828   Gene: FBgn0246180   Transcript: FBtr0279390
Sequence length 91
Comment type=protein; loc=XR_group3a:join(760104..760109,760161..760430); ID=FBpp0277828; name=Dpse\GA24795-PA; parent=FBgn0246180,FBtr0279390; dbxref=FlyBase:FBpp0277828,FlyBase_Annotation_IDs:GA24795-PA,GB_protein:EDY73300,REFSEQ:XP_002134673,FlyMine:FBpp0277828; MD5=637b4c13eedc6cb4522c315255250292; length=91; release=r2.13; species=Dpse;
Sequence
MTLKAIRRYPTCGPDHFTASVSGNGDKNKGCIPASWRCDGQKDCPDKSNEVGCPTCRMDQ
FSCQSGECFDMPLVCDGTTNCHNGHDEVDLS
Download sequence
Identical sequences FBpp0277828 7237.FBpp0277828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]