SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0278645 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0278645
Domain Number 1 Region: 4-287
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.92e-105
Family Inorganic pyrophosphatase 0.0000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0278645   Gene: FBgn0246465   Transcript: FBtr0280207
Sequence length 291
Comment type=protein; loc=3:join(17254709..17254772,17255254..17255372,17255432..17255827,17255892..17256046,17256121..17256230,17256540..17256571); ID=FBpp0278645; name=Dpse\GA25082-PA; parent=FBgn0246465,FBtr0280207; dbxref=FlyBase:FBpp0278645,FlyBase_Annotation_IDs:GA25082-PA,GB_protein:EDY69489,REFSEQ:XP_002138931,FlyMine:FBpp0278645; MD5=f12018d28413a3aa110008c2f6d79230; length=291; release=r2.13; species=Dpse;
Sequence
MSKYETAEKGAKNSPSYSLYFKNKCGNVISPMHDIPLYANEEKTIYNMVVEVPRWTNAKM
EISLKTPMNPIKQDIKKGKLRFVANCFPHKGYIWNYGALPQTWENPDHIEPSTGCKGDND
PIDVIEIGYRVAKRGDVMQVKVLGTIALIDEGETDWKIIAIDVNDPLASKVNDISDVDQY
FPGLLRATVEWFKIYKIPDGKPENQFAFNGDAKNADFATSIIAETHKFWQTLIHQSSVGD
HSISCTNITNHNSEFVIPKDEADKLFAEAPEGGQVEEVLDTVDTWHFIHLK
Download sequence
Identical sequences FBpp0278645 7237.FBpp0278645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]