SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0273605 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0273605
Domain Number 1 Region: 2288-2550
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-46
Family YWTD domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 1336-1595
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-45
Family YWTD domain 0.00000517
Further Details:      
 
Domain Number 3 Region: 3110-3374
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-43
Family YWTD domain 0.00000477
Further Details:      
 
Domain Number 4 Region: 613-845
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.0000234
Further Details:      
 
Domain Number 5 Region: 3985-4256
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-39
Family YWTD domain 0.0000164
Further Details:      
 
Domain Number 6 Region: 279-508
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-34
Family YWTD domain 0.0000466
Further Details:      
 
Domain Number 7 Region: 1969-2230
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-34
Family YWTD domain 0.0000394
Further Details:      
 
Domain Number 8 Region: 1642-1917
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-32
Family YWTD domain 0.00025
Further Details:      
 
Domain Number 9 Region: 1252-1328,1913-1961
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.67e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 164-264,533-582
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.22e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 11 Region: 2632-2675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000249
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 12 Region: 957-998
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000118
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 2757-2799
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 101-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 3683-3720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 16 Region: 3472-3512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 17 Region: 3724-3761
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 2938-2977
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 2982-3016
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 20 Region: 1001-1037
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 21 Region: 2597-2635
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 22 Region: 3557-3595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 23 Region: 3030-3068
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000463
Family EGF-type module 0.029
Further Details:      
 
Domain Number 24 Region: 1042-1079
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2898-2933
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 3767-3804
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 27 Region: 2806-2842
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 3515-3553
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 29 Region: 3899-3953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 30 Region: 3855-3891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 31 Region: 922-957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 32 Region: 1130-1162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 2673-2714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 1078-1119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 3810-3846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 36 Region: 3054-3102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000632
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 37 Region: 66-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 38 Region: 1165-1199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 39 Region: 2721-2759
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 40 Region: 3434-3469
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 41 Region: 3641-3679
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 42 Region: 3593-3637
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 43 Region: 1209-1244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 44 Region: 2853-2891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 45 Region: 4314-4345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000761
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  FBpp0273605
Domain Number - Region: 2236-2283,2562-2618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000115
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 38-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000746
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number - Region: 3377-3433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00285
Family EGF-type module 0.009
Further Details:      
 
Domain Number - Region: 1598-1634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4260-4284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0264
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0273605   Gene: FBgn0071481   Transcript: FBtr0275167
Sequence length 4543
Comment type=protein; loc=XL_group1a:join(7733813..7733843,7734086..7734361,7734435..7734689,7734765..7737083,7737644..7743298,7743366..7743577,7743642..7744048,7744464..7745968,7746069..7746381,7746666..7748852,7748921..7749165,7749232..7749458); ID=FBpp0273605; name=Dpse\GA11430-PA; parent=FBgn0071481,FBtr0275167; dbxref=FlyBase:FBpp0273605,FlyBase_Annotation_IDs:GA11430-PA,GB_protein:EAL32723,REFSEQ:XP_001355664,FlyMine:FBpp0273605; MD5=a92c1bae039d055a0e56919243e0f43a; length=4543; release=r2.13; species=Dpse;
Sequence
MTSHELPLSTAYRKCQHTDVFCNAPNGAAPAEGTRLAGPCVPKEKRCDGYLDCRTGRDED
GCNGVACRLDQFRCANGHKCIDAALKCNHRDDCGDNSDEQGCNFPPCHHAQFRCTNALCI
PYNFHCDGYHDCADKSDEANCTAIACPDNKFLCPRGGVNGAPKCILKSQLCDGKRDCEDG
SDEETNCSIASCPALSCEFKCGPSLTGGVCYCRPGQSLAPDNRTCVDLDECAEWGHCDQL
CTNTLGSYTCQCAQGYTLINESKCIAPNANNLQLIFAHDRAIMRMFAHGADPRILANATA
AAGVSFHYARNTLYWSDIKTRKVQSLPLNPLNKGLSSFDQTLPGTWAPVALAVDWVGDKI
YVADLVGQKIDVFELSGQWHAVVLGSNLTSPADLALDPTSGLMFVADGGQVLRAHMDGTH
ARSIVSEAAYKASGVTVDIISKRVFWCDSLLDYIESVDYEGAHRVMVLRGQQVPSPSRLA
LFENRIYWTDATKQGIMSVDKFEGPSSIQVTYKAKDIREPKGIIAVHALSQPRVSNPCGN
NNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQLETDLKLCKPVGEFLMYSQQRFIKGKVL
EPVIEGFSDAIMPVVSRRARFVGLDFDARDEFIYYSDVLQDVIYRVHRNGTGREIVLASQ
NEGVEGLAVDWASKNLYYIDSRKGTLNVLSTRNVTHRRTLLKNLKRPRAIVVHPNRGFIF
FSEWDRPANITRANTDGTGLLVFKNVTLGWPNGLSIDFKEDRVYWCDALLDHVQHANLDG
TDIKTVNSRLVRHPFSIVIHNDWMYITDWRLDAIIRLHKLTGEQEEMMVREPQTNRLYGV
KVYSHEVQRIADTQPCNRNNGGCQKICFAVPIAPQNATAGGAEIAPSVGRLQARCSCPYG
ERLAEDQMSCVPDPSAEPPVQPCPNSWDFTCTNQRCIPKSWVCDGDDDCLDNSDEEQNCT
KPTCGSNEFQCRSGRCIPQNFRCDQENDCGDNSDELDCGNVTCGTSQFACANGRCIPNMW
KCDSENDCGDSSDEGDFCAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPP
ISCLTNQFKCSDLRQCVEESYKCDGIPDCNDGSDEVGCPSMGPNQCNLEKHFRCKSTGFC
IPIAWHCDGSNDCSDHSDEQDCGQITCAQNFFKCNNTNCVFKAYICDGKDDCGDNSDEGA
EHACVPPPFKCPHGQWQCPGVSERCVNITSVCDDTPDCPNGADEGEGCDLAECEHQTGQC
SSFCQKTPNGALCVCPPGSEIGDDGFTCNDTNECDPPGLCSQQCTNTKGSYFCSCQDGYV
LEPNKHTCKAVNHTAAFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTIFW
SDMKLKKISRLDRGMEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNR
LVLVRENITQPRGMCIDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGL
TLDIATKRVYFADSKLDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQLN
RVLSANKFRGKNQTVVSHLISQPLSIHVHHASLQPMHPNPCAQAKCQHLCLLSPSVTEGY
SCKCKPGFKLLSEGRCIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIESSTGLD
FDRKGETLYWVQGREDDDENCTIYTTPYGGGNKTLFLGADNGIVGAPYTIAFDWLGRNLY
IGNRVASNIEAVRVDGKQKYRTIILANDGYPNSVSRPKQIVLDPSEGKLFWIDNGVLEVP
VKIGRVDMNGQNAQLLFQDLTHPESIAVDIDKKMLYYSSSNPPVIGSMDYNGEDHTIIMT
DGHPIAKPRSLGILDHRLYYLDPVYEKIVRVDLPNGDNRKTIVDNEPDLRSMMIYKKRAT
MQHPCQTNNGGCKHLCIPGPAATRTCACGIGYRKENEINCVAYKTFAVVSQLDMIRGYSL
SDSSEAMVPVSGPGHHILHVDVMYREQWIYWAEFNRGYWNGIFRSRPNGTDLQHVVKDGI
GSNGIRGLTIDWVAGNMYFTNVYPHENYVEVSWLDGSNRKVLVKTTNDAPRELAVDPIKR
LLYWIDYGQHPRIGKALLDGSKWTPLVTSGISLPRDLTIDMQTHDIYWVDSKLDTIQKIS
YSGANRKVIRRDLPSPMGIAVYLNDVYWVDRNLMTVFKASKHNTNDSVVTRVRTNLEKLR
DIAIYNINNQPQDDTNPCAHLGNGGCDQLCFSFPPDSGASTGGRNFRCECATGKLGADER
KCESVNEYLVFATRTEIRAVNLDPHSTEVPFTPLTNLTNVVGLDFDFADNRMLYTQIRPW
AKIAYTKANKPSHSDITVVLNKGINPEGIAYDWTQHKIYWTDSSNNSIYAMNLDGTELVM
IARVERPRAIVLDPCNGTLFFTDWGRFGTSGKIFRTTMAGSLKRAIVDKDLSQPSGLAID
YDERRLYWTDAVREKIERSDLEGRNRELLVAATIYPFAITVFRNYIYWTDLQLRGVYRAE
KHTGANMVEMVKRLEDSPRDIRIYSADRQKCDVNPCRINNGGCAQSCHPAPNGKAECKCD
DNTKVVNEGRMCAPRNNTCEASKFYCQNGRCISRMWSCDGDDDCGDNSDEDPNYCAYHSC
SPNEFRCNNGRCIFKSWKCDHENDCKDGSDELGCTYPPCVDGEFTCGNGRCIPQAQVCNG
VNDCKDNATSDETHERCPMNTTCPANHLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHC
GQRTCPTNSFRCPNHRCIPATWYCDGDDDCGDGADEPPDYCKSEGRTCFGDLFTCDNGNC
IPRIYICDGDNDCLDNSDEDNRHQCNDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDP
DCVDGADENTTLHNCATQQPCGEDMFTCGNGRCINKGWLCDHDNDCGDGTDEGKFCNSKY
KTCSPQEFTCQNFKCIRNQYRCDGEDDCGDHSDEVNCKKDNVTCPQGQFACTNGQCIDYS
LVCNKYPDCSDESDEPAHCNVDECAKVEINQCGHKCVDTLTSYYCDCNEGYKLLADGKAC
ADVDECLEQPGACSQHCSNTPGSFYCKCDETYYERQNDEHTCKRKDNIPPWLIFTNKYYV
RNMSVDGHQYNLMHQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYTGPEDETPPEREA
VIRHDSHGLEGIAIDWVGRKLYWLDRHSKNLDVSELDGTKRKTLRSGVVDPRAIVVHPGI
GYLYFTSWHLQAYIAKMGMDGSNFTRILNWNDGIAWPNALSIDYFTDRIYWADAHLDYIA
YADLEGRHRHTVLSGNRVPHVFALSLFDDFIYWSDWNLKAIVRANKFHGANYTVLRNTTH
RPYDIHINHPLRQLPYTNPCGTNNGGCSHLCLIAPPPESTYLNIEGYIEEGAPIYKCACP
NQFYLARDSKTCIANCTAGQHLCGGRDEKCIPWFWKCDGEKDCKDGSDEPATCAPRHCRA
GTFQCKNTNCTPSATICDGVDDCGDRSDEQNCELPCPLSDFKCKSSGRCILDSWRCDGDA
DCKDGSDEDPAVCFKRTCDPKTEFACKNGRCIPQLWMCDFDNDCGDDSDEPAYMCRQRNC
TTGWQRCPGQSNYRCIPKWLFCDGKDDCRDNSDELPENCPKCSAETDFKCGNNRCIPKQW
MCDFADDCGDATDENEAICKGRYRECSESEFRCGNGKCISSRWQCDHEDDCGDNSDEMHC
EGYQCKNGTFQCASGHCIASYFRCDGDRDCRDMSDEVGCPPRFPGGRYCPESRFQCNNNL
CVSLSDLCDGTDDCGDGSDEDPNVCSDFNCDTLRRFQCANHRCVARYQICDGVDNCGDGS
DENNMTLCASKQKPCDLYTQFQCANKHCIERSQVCDFSDDCTDASDELGCHHTASCSEQN
RGGCQHHCHNLTDGGYICTCYPGYIISHDNKKRCADVDECLTRQHTCSHQCHNLNGTYSC
SCREGFRLADGASGVCRAEKEDVVLVFANGQEIRGLDLQKREEFDVIAAEKRIEALDYDA
QQQIIFWADSYDKTIKRSYMVNAIDGRAKIGFAQDLNMKGGSKPTAVAVDWLASNLYWTE
MDRTGSKPRGRVMVAKTDGRYRRSIVNAGLEVPTSIAVNPQLGRIYWSDAGSAPKIEVSW
MDGSKRRPLITEQIRHPAGLTIDYSQDHIIYWVDTKLNAIESMRADGSMRKAIVKGDQLR
HPVSLDLFESNMFWVTRDTGELLRQDKFGRGVQVVLHRNLVNPSGLKVYHDRRYNTSLPN
PCDNSTCSHLCLLVPGGRRCACPDTSGPLPSHRSTAEVICDAAAEHPRPAPRICPCQNGG
LCKENDQGELVCECLAEFRGEHCEKSTTGAFGHGGANVTAVVVPIMVILLVMMAAAGAWY
VIRKRPFGKLARMPAMTSSQSVTFRHGSNVEFSESGFPGASAPGADVAPIEGYNLQTVNA
NKARDFANPMYDAVQSGTTTDPGMGNGSGIYDVPGEPSKSKAMGHPHATSGGSFTEPASA
IIAPSSITHKSSPQLQLRTRELDPSADTGKDTQFLVEEDKSEC
Download sequence
Identical sequences FBpp0273605 7237.FBpp0273605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]