SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0274771 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0274771
Domain Number 1 Region: 87-464
Classification Level Classification E-value
Superfamily L domain-like 1.5e-53
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 2 Region: 372-701
Classification Level Classification E-value
Superfamily L domain-like 6.35e-50
Family Ngr ectodomain-like 0.03
Further Details:      
 
Domain Number 3 Region: 1071-1214
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.44e-42
Family Toll/Interleukin receptor TIR domain 0.0000725
Further Details:      
 
Domain Number 4 Region: 812-952
Classification Level Classification E-value
Superfamily L domain-like 4.71e-30
Family Ngr ectodomain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0274771   Gene: FBgn0079928   Transcript: FBtr0276333
Sequence length 1350
Comment type=protein; loc=XR_group6:complement(513540..517592); ID=FBpp0274771; name=Dpse\GA19932-PA; parent=FBgn0079928,FBtr0276333; dbxref=FlyBase:FBpp0274771,FlyBase_Annotation_IDs:GA19932-PA,GB_protein:EAL30665,REFSEQ:XP_001353163,FlyMine:FBpp0274771; MD5=90b592f3d7840570053a73f233556b8a; length=1350; release=r2.13; species=Dpse;
Sequence
MLASSHMLYVLIASCVMPIFGAALSKTVLYQAPDECRWSGGGEHDITLVCHLRTINSELE
NTNFSVIQPHNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTDGSFRG
LHELRNLTIRTHNGDWSTMSLEMASNSFVDFRQLERLDLSLNNIWLIPDGMVCPLKSLQH
LNASYNKIQDISNFYFSASLSSRKARVCGSTLQSLDLSANKMVSLPSAMLSALGRLTHLN
MARNSMSFLADRAFEGLVSLRVVDLSANRLTSLPPELFSETKQLQEIHLRNNSINVLAPG
IFGELAELLVLDLASNELNSQWINAATFVGLKRLMTLDLSANKISRLESHIFRPLASLQI
LKLEENYVDQLPAGIFADLTNLHTLILSNNRISVIEQRTLQGLNNLLVLSLDYNRINRLD
QRSLINCSQLQDLHLNDNKLQAVPEALLHVPLLKTLDVGENMISQIENTSITQLENLYGL
RMTENSLTHIRRGVFDRMSSLQILNLSGNKLKTIEAGSLQRNTQLQAIRLDGNQLKSIAG
LFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIESELSLSTFDA
SYNLLTEITASSIPNSVEVLYLNDNQIGKIQPYTFFKKPNLTRVDLVRNKLTTLEPNALR
LSPIAEDREIPEFYIGHNAYECDCNLDWLQKISRESRTQPQLMDLDQIYCKLSYARGATH
VSLIEAKSNDFLCKYESHCFALCHCCDFQACDCKMECPDRCSCYHDQSWTSNVVDCSRAS
YEHALPSHIPMDATQLYLDGNNFKELQSHAFIGRKRLKVLHLNHSRIEILHNRTFYGLLE
LEVLQLQSNQLKVLNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAIG
SFAVWNFLPSYLNELHLAGNHWSCNCEFIDKLRDYISRHDYVVDRPKLRCESGGNSSQQM
AIYASTDSALPVVQCSQTLPLGLDNSYNFAEQAGGEGGALSGNMTSTKMILNQPPKQDYI
PILVAILTAFIFIMICTLLVFIFRQEMRVWCHSRFGVRLFYNGQKDVDKNEREKLFDAFI
SYSSKDELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVVSE
NFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQWGDKL
FWQKLRFALPDVSSAAQRSVAGQSCHVPINHAAYHHHHHVHQQALPLPLPHPHPHSGHHH
QQQQQQQQQQQQFMLPPPPQQPGSFRRQPSIHQQQQQQQQQQQQAALLMGGVQVGGPAPP
QMIPLVGGIQQQSLPLPPTQPTPASRNLHM
Download sequence
Identical sequences Q2M1B0
FBpp0274771 7237.FBpp0274771 XP_001353163.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]