SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0275750 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0275750
Domain Number 1 Region: 22-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.53e-66
Family BAR domain 0.00062
Further Details:      
 
Domain Number 2 Region: 306-386
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000106
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0275750   Gene: FBgn0082048   Transcript: FBtr0277312
Sequence length 392
Comment type=protein; loc=3:complement(19271296..19271424,19271481..19271727,19272358..19272548,19272636..19272671,19272795..19273292,19273411..19273488); ID=FBpp0275750; name=Dpse\GA22064-PA; parent=FBgn0082048,FBtr0277312; dbxref=FlyBase:FBpp0275750,FlyBase_Annotation_IDs:GA22064-PA,GB_protein:EAL26633,REFSEQ:XP_001362053,FlyMine:FBpp0275750; MD5=e4efa37bbf8aa470a299de5b438bd7d3; length=392; release=r2.13; species=Dpse;
Sequence
MNINLPHFNMKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKAWTEK
LVKDTESVLIPNPQNRVEDYIFEKIDKSKPKRVSNLEHLALDMIEAGGDFGQDLPYGQAL
IKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLEGEMKTISKERGILDSKRLDLDACKNR
VKKARSMLGQQSKDGISPEAALEQAERDLRVAQAEFDRQSEITKLLLDGISTSQASHLRH
LHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYIPLDLSNASANKSSATGGPSPSRGS
GNNNSSSQAASAHRPTNQPMHVNTDQMQRARVLCSYDAKDHTELNLNANEVIFVTECSPV
NEDYMYAKQGLMKGLVPRAFVEMLDEEHDVTL
Download sequence
Identical sequences Q28WN4
7237.FBpp0275750 FBpp0275750 XP_001362053.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]