SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0276276 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0276276
Domain Number 1 Region: 237-503
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-82
Family Protein kinases, catalytic subunit 0.0000000188
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-41
Family SH2 domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 46-134
Classification Level Classification E-value
Superfamily SH3-domain 6.41e-25
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0276276   Gene: FBgn0245668   Transcript: FBtr0277838
Sequence length 516
Comment type=protein; loc=3:complement(11672246..11672454,11672527..11672693,11672755..11672932,11673142..11673300,11673372..11673540,11675184..11675262,11675324..11675408,11675492..11675613,11699392..11699486,11704418..11704705); ID=FBpp0276276; name=Dpse\GA24271-PA; parent=FBgn0245668,FBtr0277838; dbxref=FlyBase:FBpp0276276,FlyBase_Annotation_IDs:GA24271-PA,GB_protein:EDY69222,REFSEQ:XP_002138664,FlyMine:FBpp0276276; MD5=5cafd35426ae436a4934f9ff0f389f17; length=516; release=r2.13; species=Dpse;
Sequence
MGNCLTTQKGETDKVNVDRIKLEDPGTAIGVVSVPQIAMPIGQPSEQVRPVPQIPESDPA
NANAKIFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKKTRSEGYIPSNYVAK
LKSIEAEPWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRI
RQLDEGGFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGLSHRTRDQW
EIDRTSLKFVRKLGSGQFGDVWEGQWNNTTPVAIKTLKSGTMDPKDFLAEAQIMKKLRHT
KLIQLYAVCTVEEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYL
ESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKEDEYEARVGARFPIKWTAPEAANYS
KFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPLPPNCEPRLYEIMLE
CWHKDPMRRPTFETLQWKLEDFYTSDQSDYKEAQAY
Download sequence
Identical sequences B4GJ00 B5DZR9
7237.FBpp0276276 FBpp0180803 FBpp0276276 XP_002018579.1.64850 XP_002138664.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]