SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0276820 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0276820
Domain Number 1 Region: 54-271
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-27
Family YWTD domain 0.00024
Further Details:      
 
Domain Number 2 Region: 404-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 440-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000143
Family EGF-type module 0.026
Further Details:      
 
Domain Number 4 Region: 371-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000267
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0276820   Gene: FBgn0071440   Transcript: FBtr0278382
Sequence length 647
Comment type=protein; loc=XR_group3a:complement(1086905..1087009,1087082..1087415,1087482..1088898,1092259..1092346); ID=FBpp0276820; name=Dpse\GA11386-PA; parent=FBgn0071440,FBtr0278382; dbxref=FlyBase:FBpp0276820,FlyBase_Annotation_IDs:GA11386-PA,GB_protein:EAL31306,REFSEQ:XP_001354253,FlyMine:FBpp0276820; MD5=7270d742462a17a12696fdc7d777c41c; length=647; release=r2.13; species=Dpse;
Sequence
MLWCPSVLVPLIAVAACLPVLAIGTPLEWEFAITLKSKILFVDEFWRTLASAAHEFDELS
ALTFDETEELIYFNDQQHRNGSIFSLRRDALMASHIAEQAIQRTGNESVGGLAYDPLNRN
LFWSDTLQKKIFFASIDSKVTETPKVLVDLSQEGARPDGVAVDVCRRKLYWTNSNITHPT
VESIDLAGTNRQVIIDTDIDMPRGIVVDQLSDRIFWIDDLKGVFFALKSARLDGSDRQLV
LHDKHHEPLNLAVTNDAIYWTDKTTKAVWSHPKVPIVKATTTTSPLKAEEEDATETIPDI
EPEPVAEVSALLRVANLSEEARGIVARTGFYQRLQKDEHCANIVRKVKERLDLMTKKKQM
RSLVDEKTAQLERDHCLNGGTYIADRVLCICPTGFKGSRCEIRECHNFCVHGTCEISDRA
YPKCYCQPGFSGERCEISKCSGLCLNGGHCKLEDISEKPSCECPHNFAGERCEQNSTEIC
ALFCRLLKHEADIYVPFGCHDICEELAKDASDKIAIPQYHHLEVCMTPSPWTSNVIIVLV
LGIVSCFFLVAVIVHGFRRLYKPKRPRIRKTFVVRKQARTNSSGDTPLTNRPLATEQCEI
TIENCCNMNICETPCFDPKLVEQTLAKSSNCKEDKKILIHNMDDDLY
Download sequence
Identical sequences Q29FE9
7237.FBpp0276820 XP_001354253.2.19638 FBpp0276820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]