SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0277016 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0277016
Domain Number 1 Region: 412-603
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-55
Family Kelch motif 0.0000208
Further Details:      
 
Domain Number 2 Region: 49-167
Classification Level Classification E-value
Superfamily POZ domain 1.1e-33
Family BTB/POZ domain 0.001
Further Details:      
 
Weak hits

Sequence:  FBpp0277016
Domain Number - Region: 330-447
Classification Level Classification E-value
Superfamily NHL repeat 0.000288
Family NHL repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0277016   Gene: FBgn0073524   Transcript: FBtr0278578
Sequence length 714
Comment type=protein; loc=3:complement(2505310..2505646,2505704..2505871,2505938..2507270,2507359..2507455,2508189..2508372,2508573..2508598); ID=FBpp0277016; name=Dpse\GA13488-PA; parent=FBgn0073524,FBtr0278578; dbxref=FlyBase:FBpp0277016,FlyBase_Annotation_IDs:GA13488-PA,GB_protein:EAL24887,REFSEQ:XP_001360312,FlyMine:FBpp0277016; MD5=098e9c499de5433f3f5cfe8a9c480f6b; length=714; release=r2.13; species=Dpse;
Sequence
MFLPVKSNHSGEASGNNEDVTTTSNNSTQTPSDLSPPGPNEEVLPQAHHQNPGHCIASFA
AINQMRTNAQLCDVRLEVGGDTIHAHRVVLASVSPYFYAMFNDDMLERTQGLVRLHDVDS
TALRQLIDYTYTGEITITEQNVQVLLPASGLLQMHSVRDACCKFLLRQLHPSNCLGIRSF
ADAHSCKELHTRSHKYALQNFQQVVGTEEFLLLPFEEVRELISNSQLNISSEEKVFMAVV
NWVKHDLTTRRLHTSELMSHVRLPLVSRDFLMSCVEAETLMRDDSECKELLLEAMKYHLL
PEQRSVMGSQRTQERRPEGMKPYVFAVGGGSLFAIHNECEVYNPRSNTWSPVAPMLWRRS
RSGVTSLHKQLYVVGGYDGVSDLATAESYNPLTNKWSNITPMGTKRSCLGICSYDALIYV
CGGYDGASCLSSMERYDPLTGIWSSCPAMSTRRRYCRLAVLENCIYSLGGFDSTNYQSSV
ERFDPRVGRWQPVPSMTARRSSCGVASTDGHLYCIGGNDGTMCMSSGERYNLRRNTWEPI
AAMHSRRSTHEVVEVEGALFALGGNDGSSSLNSVERYDPRLNKWSVVNAMVARRSSVGAA
VLDISESFAAASASSASNTNGSAAVAASVTGGTLTVPSRAEAAAFTANIALSSSAPSASS
TLRRHRRDTPGLAETRRTNSNASSSSGSGSGSESGSSATSGTGAGGGVKPPATA
Download sequence
Identical sequences FBpp0277016 7237.FBpp0277016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]