SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0277390 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0277390
Domain Number 1 Region: 2949-3209
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000606
Further Details:      
 
Domain Number 2 Region: 1248-1473
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-38
Family YWTD domain 0.0000083
Further Details:      
 
Domain Number 3 Region: 2151-2394
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-30
Family YWTD domain 0.0000426
Further Details:      
 
Domain Number 4 Region: 3775-4008
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-29
Family YWTD domain 0.00027
Further Details:      
 
Domain Number 5 Region: 589-782
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-28
Family YWTD domain 0.00024
Further Details:      
 
Domain Number 6 Region: 1848-2102
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-27
Family YWTD domain 0.00023
Further Details:      
 
Domain Number 7 Region: 1528-1778
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-26
Family YWTD domain 0.00028
Further Details:      
 
Domain Number 8 Region: 278-463
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-22
Family YWTD domain 0.00032
Further Details:      
 
Domain Number 9 Region: 1161-1256,1474-1521
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000361
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 10 Region: 3458-3497
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 11 Region: 3375-3415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 2607-2644
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 13 Region: 3292-3332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 3575-3612
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 15 Region: 2445-2484
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 16 Region: 3657-3695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 472-508,792-842
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000361
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 18 Region: 3495-3535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 2482-2523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 20 Region: 2523-2560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 21 Region: 3419-3453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3537-3576
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 3610-3653
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 24 Region: 2685-2717
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 2785-2819
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 26 Region: 2896-2939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000948
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 27 Region: 1073-1112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 3256-3292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 2825-2861
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 30 Region: 938-976
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 31 Region: 2861-2903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000695
Family EGF-type module 0.011
Further Details:      
 
Domain Number 32 Region: 2734-2770
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 33 Region: 20-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000969
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 2646-2677
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 2573-2603
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 134-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 37 Region: 856-890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000101
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 38 Region: 1019-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000128
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 39 Region: 4179-4214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000166
Family EGF-type module 0.02
Further Details:      
 
Domain Number 40 Region: 2107-2155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000325
Family EGF-type module 0.02
Further Details:      
 
Domain Number 41 Region: 4253-4291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000449
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0277390
Domain Number - Region: 3331-3377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 4214-4250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000176
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 983-1016
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number - Region: 1123-1157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 4306-4343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000364
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 4101-4147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000404
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 64-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000641
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 4145-4182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 3218-3273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0052
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1789-1830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00662
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4350-4382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 3697-3733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 897-936
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0144
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number - Region: 4065-4099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0898
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0277390   Gene: FBgn0246030   Transcript: FBtr0278952
Sequence length 4552
Comment type=protein; loc=3:join(2084352..2084379,2085067..2085210,2085278..2085400,2085469..2085720,2085796..2086083,2086145..2086521,2086610..2087352,2087411..2088478,2088537..2089931,2090311..2090557,2090622..2090917,2090980..2091335,2091400..2091665,2091728..2092852,2092927..2094457,2094534..2096571,2096640..2097026,2097088..2097901,2097972..2098536,2098602..2099937,2099997..2100123,2100185..2100337); ID=FBpp0277390; name=Dpse\GA24641-PA; parent=FBgn0246030,FBtr0278952; dbxref=FlyBase:FBpp0277390,FlyBase_Annotation_IDs:GA24641-PA,GB_protein:EDY68770,REFSEQ:XP_002138212,FlyMine:FBpp0277390; MD5=ecddadb0621b1ee43c762a17a9abf0b9; length=4552; release=r2.13; species=Dpse;
Sequence
MRTPEDQRKTAAAASLLGPHCNEGQFRCVPSLKCIPETWRCDGEYDCGEGDLTDEVNCTD
AVALQCRAFEGECHNGECLELSRFCDGHWDCDSDELQCDKQDAACAAMNCSYNCKLTPRG
PRCYCPGGQVPESLNSTRCVDHDECQEPGTCDQLCRNTPGSYECSCVSGYDKAKGGRCRA
INVPSSEPATLTLFSNGSVLHISLQELQANASAEKAAAGGLLSVLTLPQAHAFEVWHRNR
TICALQSSRDGLWLQCQRIDEPKANWTLPVSPLVSPKQSFLELHLDWIAGNWYLLNKDHG
LVFFCTNTMLFCRLILEQVRDPESLALDPTKGYMFYTDRTPSLSRSLLDGSNRTALVSTH
IYHPNTVTLDLANEHVYWVDVYEDVIERVDYEGQRRWTLKKFPDSPVLLRSLQAIEVFEN
TIYLSPWTGNVIVALDRFTHKTHLLRRNVTRATNFRIFHRQKQPEVAHPCRENNGDCNQI
CVPLWTRGFASARCLCTAGYKLHNQTTCLLAAQDKFLVYSDKRLSRIAGVPLGTEQVQQL
EQLGELPDVMVPIYNASIGQTIDVNVRAKSVFYVVRDDLDLGVLEEPSFSIKCQSLNGSV
SRSLAHGLERVHSMAYDWINDHLYWATNMKLHVAPLRNMSQVLTFATECDAMSIDLDPTT
GLLYWTQWSIQTCLAGIYSAWMDGTHKELLAKGTTEMPMHWPRSLDVDRRAKRIYWCDSL
RGTIERMRLDGTGREVLLKSDQFHPYSMVQHNAMIYWVGTKNSSIWRFHVHHGNQTSTVH
LQSSGRSADLRIFDVATQPMPQTPSACSQSKCPGMCLNTPKGAICRCPDGFTLNGTGTHC
IPQLAPATVAATVRRNCSSAFQCRQSGDCIDNKDLCDGFDDCSDGSDESSDATGPCNPQN
CDKDHHFVCNGRCYQRSLLCSSIAYCSDGSDQANCEHITCNSNEFTCAKTGRCIQMTWVN
DGVVDCGPTDNSDESSEIFFGSKCPEFDCGNGRCRQFTDICDGIDNCGNNIDEFGCDQEC
GHGEKYCRPIGCYGEMHMCDGIHDCEDFSDEANCNQTAKSDNHPVSGWKELGECAAFEFA
CQDPFECIPDFLRCDGIPHCYDKTDETNCTVITATKFDMNETVICEHPDRLCGFTRQCIS
VDQLCDGKNDCEDTTDEGFLCADKLCDHGHECSHNCHNTPEGYICSCPDHLFLQPNGKRC
NMQHACDHWDTCSQVCQTSGKGYDCRCLEGFDLAYDKFTCKSTAPDEPFVIFTNRQDIKG
INLKTMAVGTFYTSLRNIIALDFLYSNESSVEVYWTDVIDDKIYRGELVGESLRSVEAVI
HSGLSTTEGLAVDWVGKNLYWIDSNLDQIEVAKLNGSFRRTLIAGSMESPRAIALDPREG
LLFWTDWDDNSPRIERASMAGEGRRIISTSWQLSTGWPNGLTLDFTQKRVYWVDAKSKSI
SSIKYDGSEHHVVLRQPDILSHPFAISVFENYVRQPWERNPCGDNNGGCSHLCLLSGRGT
FKCECPHVMRLDPSDERNCVPNEQVLLFVMVDEIRGIDLHQPNHHTIPTIRQSPRLVAPQ
RIDFLVDEGRIFWSDIQQNEISSAGISNGLIEPIINTNIEKPYGFAIDWIARHMYFSSGQ
IRCNILASNLKGEYVTHIHEDLNMVDSIALDPANGKMYWIHSAPDASLWQLEQSNLDGSG
RLLIYEHEHTLQSLTMDFDAQRLYYAYDNSGIAYYDIPKNETHKVLVASQITSISSLTVY
NGTLYFPENIQSVIMHCEKEACSNMSFLRVNTKSIQSMKMFYADAQTGTNTCAGPLRGGC
EHLCLAISATEHVCRCALGYDVEPHNPTRCIPRAEFIFYSIDVLQGVEIVDPADQPTPPQ
SALVPISRVSSASFIDYHAATDMLYWGDNEVGSISRVKRDGTQRETILEAINLAGYKQQD
WLGGIAIDWVAGNIYWSDTKRNLIEVSRLDGSHRYVVVANVEKPTVLAVDPLQGLLFYVT
QQHIGRVGLDGSQPFVLVNQTRTNWAVGSLVLDIEATKVYWCEQHPDALMKVDYDGNLRL
QLLNETLNNPVALAKMGDYLYWAENKYNEGAIKVAPLSNLTQSKLVLQTEQDAIRDLKIY
SKRIQRGNNPCEQSNGGCEQLCLYNGTSVVCACAHSHLAADGLSCEPYENFLLFSYRSNI
ESIHMTEHANKNWPVQLISNTSMMRNVIAITYNYEEQLVYYSDVQLSTINQVHFNGSGQR
VLVAQQGRVEGLAYDIHSEQNLQHVKTVLSLQPKDKPRGITVEPCLGMIYWTNWNEESPS
IQRAYLTGYGTEKIIRTDIKMPNALTLDLEEQKLYWADARLDKIECTNYDGSNRVVLAHS
TPKHAFAMAVYGDLLFWTDWVLHAVVRANKYTGTDVLFLREHVTRPMGIIAVQNSSINCE
ANRCKILNGQCEDVCILNKSGLASCHCTQGVLAADGRRCIAPVNTNCGKSQFTCRSGECI
PMELTCDNVTHCLDGSDELRSYCIFRQCPDTHFMCQNHRCIAHEHTCDGIQQCGDGSDES
AMLCSCQPDQFRCASGECISNKFLCDNMKDCRDFSDEKSCPPRPCESGDMAFEHCENSTI
CIMPSWRCDGDSDCPDGTDELDCSNRTSCDEDQFHCASGNCIAGSWRCDGEKDCPDGSDE
LGCRRACDGNQFACDNGCIPASWQCDGKSDCEDNADEGPQCSSRACRPHLFQCKSSGRCI
TQKWVCDGERDCPIGSDGQGGEDEGPQCGGIAHIPDCPPPAHLCTSGICIDSQYVCDGDE
DCPGGDDEYEGCEPAYPQHACPGGTQMHQCQDGHCILKNQTCDGKMDCGDGSDEMASLCA
HTRGCNGTDDFRCKNGACISADLLCDRRNDCADFSDEELCNVNECLIPDICEHECVDKVV
GYECLCRPGYKLLPKSPHLCTDIDECHEQQPCSQTCVNTYGSYKCICAKGYALVDHHTCK
ATSNVSMELIFSNRYYIRQVNMEGNGTILINELSNAVALDFDWDSQCLYWSDVTSTVGTI
KRHCPAENRTQTLHQTMLKNPDGLAVDWVAKNLYWCDKGLDTIEVSQLDGKYRKVLISEY
LREPRGIALDPYQRHIYWSDWGDNPHIGKAGMDGSNPRMIIRENLGWPNALTISFETQQL
FWGDAREDTISVSDLDGNHTRLLLARSLNPGLNLHHIFAIAVWEGRIYWSDWETKSIEYC
HMYSGQNCSTLLTTIHRPMDLRVFHPYRQQQPVSGNPCLSANCSTLCVLSPEAPYYKCIC
PTNFILADDGRTCRANCTAAHFECVNTYKCIPFYWRCDTQDDCGDGSDEPDTCPPFHCEP
GQYQCANKKCIHPSHICDGVNQCGDSSDELNCDKFTCFDTHLKCGATANSSAFCVDNVKR
CDGVRNCPGGEDEAGCTPLVCKKDEFQCGNNRCMTYVWVCDGDIDCPDKSDEANCDDVSC
GPNDFQCDSGRCIPLAWRCDDEHDCPNGEDEPASCFTSKATCDPTYFKCNNSKCIPGRWR
CDYENDCGDGSDELNCQMRNCSESEFRCGTGKCIKHNYRCDGEIHCDDSSDEINCNITCK
SNQFKCAAFNTCINKQYQCDGDDDCPDGSDEVNCTCPADHFSCGNGKCIMSRWKCDGWDD
CLDGSDESYATCAHVHCHTNAFKCNNLICIRNSALCDGVNDCGTNEDESDQVCAALPKCR
HDQFQCENDDCISKIFRCDGQYNCIDGSDEINCQPPVCGFGTCSQICIEKKAGHFNCKCA
EGYHKGAEKNATCLASGPDQILLLASEQEFRFILPSKQEGTTVVGFFQTDSLKIDVFDIL
IRPKDTLLFWIDSHHGKVHTMKIATPHVEAAGVRVRRDLKELTAFNIPELDDPKSLAVDW
ITQRVYIIDSRHNKILATDIEGKKYISLVSTGTNPTDIVLEPESRIMIWSTLENGILVAS
LDGSNKKSLVERDVGWPISLSMDYPTGRLYWADYRKGTIETCRLNGKDRNVVRRFGIREK
PQKIDVFEDYLYIKLYDQSIIKMNKFGNDNGTYLLKGYRSSDIGILHPMKQNRNISNPCL
KDPCKAFKALCILSSESARGYSCKCAEGYVMTDEALCKAHADVPDYCPLQCNLGSCQIVD
HVPKCICQPQFEGELCEHYRCSGHCLNYGLCTVAPQLPGSLDAPPLKCTCTPGWSGARCE
TSLPACQSRCHNGGSCLISETEGMKCSCPDMFVGEQCEHCLNLTCENGGVCRETLTGTPQ
CECPDGYTGKRCEINECADFCKNGGSCVIGSKGQRQCKCPSGFYGEHCESSSCRDYCQNG
GTCSERGRYLNCICLSRYYGRRCEMDLCLTSDPPQFCEASQVPVRNPCTGIICQNAGTCH
VIKGVAMCNCTDQWNGDFCTMPVLEDNPCIRYCANGGVCHLDEYVRPHCSCIGEWQGNAC
ELPPHCVGGECNVCRPGSSINECLCGSQKVVPCLTDSAEGALKGDQEPTQSGSVLSMLAV
ILSVTLLVVALFAGAIYFLKKHRIAQPFSHARLTDNVEIMLTNAMYRGDADEPPTFSTED
DKGNFANPVYESMYADAIAEPASTEIAHSTGPDERKGLLQHTHDETHTPDIL
Download sequence
Identical sequences 7237.FBpp0277390 FBpp0277390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]