SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0277950 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0277950
Domain Number 1 Region: 838-911,992-1081
Classification Level Classification E-value
Superfamily RUN domain-like 6.15e-32
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1234-1303,1342-1428
Classification Level Classification E-value
Superfamily RUN domain-like 9.15e-23
Family RUN domain 0.02
Further Details:      
 
Domain Number 3 Region: 1090-1183
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.38e-17
Family Lipoxigenase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0277950   Gene: FBgn0080628   Transcript: FBtr0279512
Sequence length 1439
Comment type=protein; loc=XR_group3a:join(1116724..1116988,1117050..1117159,1117511..1117923,1117994..1118283,1118351..1119422,1119492..1119698,1120346..1120526,1120608..1120947,1121014..1121143,1121217..1121467,1121542..1121687,1121766..1121884,1121953..1122329,1122389..1122807); ID=FBpp0277950; name=Dpse\GA20634-PA; parent=FBgn0080628,FBtr0279512; dbxref=FlyBase:FBpp0277950,FlyBase_Annotation_IDs:GA20634-PA,GB_protein:EAL31310,REFSEQ:XP_001354257,FlyMine:FBpp0277950; MD5=5db95cb1330d297add4a8226465e0967; length=1439; release=r2.13; species=Dpse;
Sequence
MTTRDNVVSSRLSKLMLNNATSSSTTSTATTHNGQTPASMVQSPTSPGEQSELNQLKRDA
DPQFSRFADYFVICGLDLDTGLEPDRFAGDNLHCSPLDRAYKSKPLAHYPEHVAWNPFDA
HGICMLSLPQGLRFRTQKHNIEPRFHSFATTREDGKRCYGFSLVFYEEIRNRNICGAIHT
LQSMFITELSNGQQTHSLSRVKQDGPVSRSLPRHFKVAGQAPQSAQSYYDINKDKLYVAK
SISLICQAPYAFAAQIFLKNLYRCLPRQPGAGISLESYVYNILYEVMLPQPGKSIRVYLP
PTEPHMAAIALILQRPLLATELPLLDFPLRLLFKYLGVECVIQLLTCVLLENQVLLRSTD
YQRLMIVGECITSLLFPFVWPHVYAPILPAALHHFLDAPVPFVMGLHAGCEAAHKIGSEA
ALCFVDIDKKLIQLPEEMPVFPHKQDFMAEISSVLDKFEIERDRDQEPSLKNGYAGRGGS
VGGGGGVDAMISSCTLPTGLQAARRSKERFQQLQETVYTLSGPGQSPGGGPVDYQPLTAH
PSKIDHVPRIADFLRRKGGIRGTQGGSPVGSPTVSLSSSPVGVYHDVDAVDATMPVPRRT
EKPKLSVVEQYYQDLRINNSVREVFLNRFVHMFHAYEYFVIYPNQAKDEWLSNRETLQNF
DKSSFLSDQPEHHRAFLSRFLESQMFATLIDNKILSMWESLPDEQLQLFDHRVKLLRRRH
GENMICATSYEPCVLSQDSQQGFEKRLNCIDIEVTPPSEILSNRAAYFRSFPLLEKGVLN
QECASRGNSLRRVKNGNKWRAREISLDQKAPSANSINRLSANLTTADVSPALIAQANWTF
VERLLKDIKSKSKRMLLEKMGNEAVALGLKGDGIEENTLIASMCDLLEKIWSHGLQNKQG
KSALWAHLQAYIEMQEARIGGDSSGVEQTAPVSSSPSNKMAIATASPALAWNAMRKRMDY
LSTFQTDFDSPPSPNRSRSRDRNKFVGLEQLCPLPESLEFDVKNVLAMADIKTHIGYTRA
WVRLSLEKKLLSRHFRTLLSDESLLRSLYKRSAFLRCEEEKEQFLYHLLTLNTVDYFSFT
NIYPTTKLPYRVVIFPSRKYGSYHTSSNVWIMVSGTMNETQRVPVPKGSLEFIFHYKNLG
LLTTMRIGHDNSGPSHKWLVEQVVMRNEVTGHTYKFPCGRWLGRGVDDDSTERLLVGQRI
STSVKNAELVPDTRTPPRTRSPSVQRQESLAPSEIQHQLGNCVNVIVKWHYKPSRDRDVG
TLTNLLCGDDGLVKCLEQVFLCGFRSARFFGRNLYIWDYFTKVKELFEQNLQLELEDSAS
SMDSSFSNSSGSGNSLQRREITSIWRLYVQLMDEINGTALGKDGKFQLLMCLSLREHLLT
RLIKPMALTKVTQEMYDEESFLRRRNLLTFFIQILEPLDDCHIVLENSITQGIRIPSQC
Download sequence
Identical sequences Q29FE5
7237.FBpp0277950 XP_001354257.1.19638 XP_015042460.1.19638 XP_015042461.1.19638 FBpp0277950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]