SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0278316 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0278316
Domain Number 1 Region: 418-753
Classification Level Classification E-value
Superfamily L domain-like 4.76e-50
Family Internalin LRR domain 0.075
Further Details:      
 
Domain Number 2 Region: 116-439
Classification Level Classification E-value
Superfamily L domain-like 3.74e-47
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 3 Region: 837-1012
Classification Level Classification E-value
Superfamily L domain-like 5.35e-29
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 4 Region: 1094-1241
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.4e-22
Family Toll/Interleukin receptor TIR domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0278316   Gene: FBgn0081179   Transcript: FBtr0279878
Sequence length 1445
Comment type=protein; loc=3:12840535..12844872; ID=FBpp0278316; name=Dpse\GA21191-PA; parent=FBgn0081179,FBtr0279878; dbxref=FlyBase:FBpp0278316,FlyBase_Annotation_IDs:GA21191-PA,GB_protein:EAL26021,REFSEQ:XP_001361443,FlyMine:FBpp0278316; MD5=8dfa663a8703719ff868cf1d0f291268; length=1445; release=r2.13; species=Dpse;
Sequence
MEFPLLLPLVSVLLLGSASDWSCLAALAPKESGDNSASAMLGGGAGSASVSLSGDYSSLL
SAAMPPASADDSSPAAPAHSGPSNQCSWTYNGTSSVHCALRLIERQPGLDLQGADGSSQL
TIQCSDLYLFESTLPVAVFARLQTLETLRLEACKLLQLPNNAFEGLGTLKTLRLSSHNAE
WGPARALELYPDSLNGLKQLTELDMSDNNLRALPAGFLCPVGNLQALNLTHNRIRTAEQL
GFADMNCSGGSELQLLDASHNELRSITESWGISRLRRLQHLNLQHNNISELSGEALAGLA
SLRIVNLSNNHLETLPEGLFAGSKELREIHLQHNELYELPKGLFHRLEQLLVVDLSGNQL
TSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLP
LYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEQAVFKNCSDLKELDLSSN
QLNEVPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDL
PRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLSDINGVFATLVSLLWLNLSENHL
VWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIE
LLFINNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKALPEFYLGGN
PFECDCTMDWLQRINNLTTRQHPRVMDMPNIECVMPHARGAAVRPLSALKPQDFLCRYES
HCFALCHCCDFDACDCEMTCPHNCTCYHDQIWSTNVVDCGGQQTMELPRRVPMDSSIVYL
DGNNFPVLKNHAFIGRKNLKALYVNGSQVAAIQNRTFASLTSLQILQLADNRLQTLHGYE
FEQLSSLRELYLQNNLLATIENATLSPLVSLQLLRIDGNRLVTLPIWQLHATHFGRRLRS
IALGRNQWSCRCQFLQALTSYVAENALIVQDAQDIYCMAAPNTAGYDASSYDSSSSEGSL
QKRELDFNSTGAACTDYYSGGSMLQHGIPESYIPLLAAALALVFLLVVIIIVFIFRESLR
IWLFAHYGVRVFGPRCEESEKLYDAVLLHSAKDSEFVCQHLASELETGRPPLRVCLQHRD
LAHDATHYQLLEATRVSRRVVILLTRNFLQTEWSRCELRRSVHDALRGRPQKLVIIEEPE
VAFEAESDIELLPYLKTSAVHRIRRSDRHFWEKLRYALPADYPTYRGNNYTLDHNHERVK
QPASPGLLYRQAPPPAYCGPAEGGAPSATTAPAEQNYSTATTATPSPRPQRRGDHHGGVS
GSGAAAAPHGHHLHAQYYQHHGMRPPSEHIYSSIDSDYSTLDNEQHMLMMPAGPVVSLEG
TPRAQTWRPKQQQQQQPGLQSGPSSVGHVATMGPSGKTPPQQQQQQQQAVGSGQQQGPHV
QAYLV
Download sequence
Identical sequences Q28YE4
7237.FBpp0278316 FBpp0278316 XP_001361443.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]