SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0278320 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0278320
Domain Number 1 Region: 370-701
Classification Level Classification E-value
Superfamily L domain-like 2.72e-49
Family Ngr ectodomain-like 0.041
Further Details:      
 
Domain Number 2 Region: 76-411
Classification Level Classification E-value
Superfamily L domain-like 1.29e-47
Family Internalin LRR domain 0.037
Further Details:      
 
Domain Number 3 Region: 767-947
Classification Level Classification E-value
Superfamily L domain-like 1.63e-28
Family Ngr ectodomain-like 0.0099
Further Details:      
 
Domain Number 4 Region: 1035-1174
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-22
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0278320   Gene: FBgn0081385   Transcript: FBtr0279882
Sequence length 1387
Comment type=protein; loc=3:13135993..13140156; ID=FBpp0278320; name=Dpse\GA21398-PA; parent=FBgn0081385,FBtr0279882; dbxref=FlyBase:FBpp0278320,FlyBase_Annotation_IDs:GA21398-PA,GB_protein:EAL26024,REFSEQ:XP_001361446,FlyMine:FBpp0278320; MD5=ff634ad3716ec80497761c1133b358e0; length=1387; release=r2.13; species=Dpse;
Sequence
MLAFCLLLLLTAAAVPVRSTHAQQCAWEFVRTTMDIKCNVRALDAAAPLDLQVAETANRL
ELQCSQDLLHASELSAGLFGRLQKLEELQVDACKLQRIPANAFEGLLSLKRLSLQTHNAM
WGPGKTLDLHAQSFHGLRDLSELHLADNNVRQLPEGLWCSMPSLQLLNLTQNRIRSAEYL
GFSEKLCVGSALSNANGAVSGGSELQVLDVSYNELRSLPDAWGASRLRRLQTLSLQHNNI
SSLAPNSLAGLSSLRVLNISYNHLESLPADAFAGNKELRELHLQGNDLYDLPKGLLHRLE
QLLVLDLSGNQLTSHHVDNNTFAGLIRLIVLNLSNNALTRIGAKTFKELYFLQILDMRNN
SIGHVEEGAFLPLYNLHTLNLAENRLHTLDNKIFNGLYVLTKLTLNNNLISIVETQAFRN
CSDLKELDLSSNQLMEVPEAVQDLSMLKTLDLGENQISDFKNNTFRNLNQLTGLRLIDNR
IGNITVGMFQDLPRLSVLNLAKNRIQNIERGAFDKNTEIEAIRLDKNFLTDINGIFATLA
SLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVTTLDASHNRIT
EIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPVSA
EKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPRVVDLANIECLMPHSRNAPLRPLSS
LASTDFVCKYDSHCPPTCHCCEYEQCECEVICPNNCSCFHDATWSTNIVDCGKQDLVSLP
ARIPQDVSDLYLDGNNIPVLEAGQLAGKRNLRALYLNSSNLMTLQNGSLSQLSNLRVLHL
ENNKLTALEGTEFQPLNLLRELYLHNNMLTHISNGSFEPLVSLKVLRLDNNRLSSLPNLQ
YRNSLQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDSADIYCIDAGIKRELELLGNVA
GGPDCSELLDASASNISSSQDIAGGYRLPLLAAVLVLIFLVVVLIIVFVFRESVRMWLFA
HYGVRVCEPRFEDAGKLYDAIILHSEKDYEFVCRNIAAELEHGRPPFRLCIQQRDLPPQA
SHLQLVEGARASRKIILVLTRNLLATEWNRVEFRNAFHEALRGLAQKLVIIEETSVSSEA
EDVAELSPYLKSVPSNRLLTCDRYFWEKLRYAIPIELSPRGNNYTLDHHERFKQPVSPGM
IFRQAPPPPAYYCTEDMEANYSSATTATPSPRPTRPGGPARIVDSMPMPMRPPSEHIYHS
IESEYSAYDQHEALSMIPTGLMHHHQHQQQQLARHHQQQQQQRLLQPQFRAVGAAMPVPQ
QATAPVHLRSGSGLSQASTSTQSTAQASTSAAAAQQQQQQQQQQQQQQQQTAANGETANK
NGQAFLV
Download sequence
Identical sequences Q28YE1
XP_001361446.2.19638 FBpp0278320 7237.FBpp0278320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]