SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0278393 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0278393
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 8.24e-39
Family MIR domain 0.003
Further Details:      
 
Domain Number 2 Region: 1079-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-20
Family SPRY domain 0.025
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000029
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4210-4272
Classification Level Classification E-value
Superfamily EF-hand 0.00000221
Family Calmodulin-like 0.04
Further Details:      
 
Domain Number 6 Region: 2261-2355
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000085
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0278393
Domain Number - Region: 449-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00547
Family GUN4-associated domain 0.072
Further Details:      
 
Domain Number - Region: 1537-1662
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0736
Family SPRY domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0278393   Gene: FBgn0070650   Transcript: FBtr0279955
Sequence length 5131
Comment type=protein; loc=3:join(13899911..13899964,13901552..13901755,13902738..13902815,13902884..13903272,13903337..13903861,13903932..13904056,13904113..13905535,13905603..13906206,13906388..13906487,13908332..13908536,13908601..13909360,13909418..13910589,13910814..13911008,13911088..13911203,13911284..13913562,13913634..13914113,13914365..13914502,13914685..13914959,13915031..13917128,13917321..13917433,13918210..13918555,13918741..13919041,13919355..13919465,13919522..13919941,13920013..13920214,13920278..13922960); ID=FBpp0278393; name=Dpse\GA10593-PA; parent=FBgn0070650,FBtr0279955; dbxref=FlyBase:FBpp0278393,FlyBase_Annotation_IDs:GA10593-PA,GB_protein:EAL26117,REFSEQ:XP_001361539,FlyMine:FBpp0278393; MD5=974ca2d31d56a1e5698c28fe95abe2c2; length=5131; release=r2.13; species=Dpse;
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVVYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSVFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEITMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAYLWTGGRKSLVVDAITEEPYIRKGDVIGVAIDLSVPVITFTFNGVKVRGCFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKYAPPMGFSALVQCLMPHQILSLDPCFYFGNLNKN
VLAGPWLIEDDTAFVPKPVDTSGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYHRIHPCLTQFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSDNHRS
PHLVPYSKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFSAFRT
YRVERNYAVTSGKWYFEFEVLTAGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHA
GSIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFAEVTAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWE
EIKIRQYRLMREAQAAAAQAQNAQTAAHMDHMLTGGFNMNDIKGLTRGNFDDHAEAEAEH
MMRPPRTPRKGSLTRNITFESDMSAALDEMQRSTSVLDMNGLGEEIDDKKKRGRSPFKFF
SKKSRDQSREKMGSRTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPSSPVQQQ
AQQGPKQLSSSNLGQPPVESSGNEMFDADCLKLINEYFYGVRIFPGQDPTHVYVGWVTTQ
YHLHSREFNKNKVRRGSVYIEDDYEVPIERIDRQSCYVVRADELFNEVTQDASGKGASQG
MFVGCFVDTATGIIRFTCEGKETSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTL
PLSAAVLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTSLQVHALKLSDIRGWSMLCEDP
VSMLALHIPEEDRCIDILELIEMDKLLSFHAHTLTLYAALCYQSNYRAAHALCQHVDQKQ
LLYAIRSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGTELKELYADEEMQH
SLRSLVTESVRPQLRMTEITPPVIATSSMPSVSSEPIPDIDQLYSPKFPLEVVRQFVMEA
LKDAVEINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQKLLVMVDPETWDAK
FEKEGKDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQ
LRRYIEIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLESDDQDNCTCGLELRGRLG
DFHDSLMQKVSLNALQEPDGTESGTAIEEIKTGPITKIYNFINTVKELEEGPKEVEEPEK
KTPEEVFRKVLIKQIVSWAEESPIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINNR
AREDVAEMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENV
MAVMMNTLGRRAQAQSDAPAQPEGGEGVPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKA
MFDHFDFLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCG
LQSNSELIEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGP
ALRGEGEGLFRAIVEANRMSERISDRCKMQDEAEGTTIAGLNFTHPLPESEEDEDYIDTG
AAILNFYCTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLTQT
GPGEEKAKTDMPSGLLPNNKQSIVLFLERVYGIETQDLFYRLLEDAFLPDLRTATILDKS
DGSESDMALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQ
REAVSDFLVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQ
GQGSYGASSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKN
TDEDYYGRQMGAPDQPQYVPHPIDTNSVHLDNDLNSLVQKFSEHYHDAWASRRLEGSWTY
GEIRSENDRKHPRLKPYNMLTEYERERYRDPVRECLKGLLAIGWTVEHSEVDVPLNHRGS
TRRQSKPQINEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCG
GVIHPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVEL
RFSYSLLEKLIAYLDRATINMKLLKPSTTFSRRTSFKTATRDIKFFSKVVLPLMEKYFST
HRNYFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVK
GIDARTLTKNCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVN
QVVLPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIE
RHRPALGSCLGAYSSCFPVAYLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMEQCMPNLE
TILSEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADH
MNPLLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTEN
MLHKEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNI
PEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGAPAVG
GKVKKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMT
EYDVIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKSEETVDEQALEKANVNSNEKGKDK
TQETVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHR
ACNIFARTYHEQWLNEENVGQEVMVEDLTQSFEDSEKSKKDEEETDSKPDPLTQLVTTFC
RGAMTERSGALQEDLLYMSYAQITAKSCGEEEEEGGDEEGGEGAEEGEGTSIHEQEMEKQ
KLLFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLK
EKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRF
IQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAG
KANFFKAIGVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHS
SQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLK
LADLIESPSFHEIDMKNEGWVTPKDFREKMEQSKNYSLEEMDFLLACCERNHEGKIDYRA
FVERFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSS
KRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTH
ASGLMATDDGGGNVRRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGIHMLSPANI
KHQIGVMQTKSIPELIVGFFKMIFYMFYYTGYAHFCVVRYIFGILLNLMRGPAPEQEDQL
PVVEEETFGRALPPLPLEEPPGTVQAFGLDINKEDNGVYKVVVHESPGNSSVEEGGESSP
EDGAAIAGELAEGEPYQEPISIVDLLGGDAAKKAAQERQEAQKAQEAAMASIEAEAKKSS
AAPQETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFESESE
GSAEEELILGSGSGAGVDMNGSGFGGSGDGGSGDGEMEDEIPELVHVNEDFFYMAHVLRI
AACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFDGLFIAEQPEDDDFKSHWDKLV
ISAKSFPVNYWDKFVKKKVRQKYSETYEFDSISNLLGMEKSAFTAQESEETGIFKYIMNI
DWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVT
HNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEMVDKKCHDMLTCFVFHLYKGVR
AGGGIGDEIGDPVGDEYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKD
NMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWN
MYQQRSWDFFPVGDCFRKQYEDELSGGGGGG
Download sequence
Identical sequences Q28Y48
7237.FBpp0278393 FBpp0278393 XP_001361539.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]