SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0280435 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0280435
Domain Number 1 Region: 29-257
Classification Level Classification E-value
Superfamily L domain-like 3.15e-42
Family Ngr ectodomain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 256-365
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000004
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0280435   Gene: FBgn0078569   Transcript: FBtr0281997
Sequence length 901
Comment type=protein; loc=4_group3:2483201..2485906; ID=FBpp0280435; name=Dpse\GA18568-PA; parent=FBgn0078569,FBtr0281997; dbxref=FlyBase:FBpp0280435,FlyBase_Annotation_IDs:GA18568-PA,GB_protein:EAL33566,REFSEQ:XP_001356502,FlyMine:FBpp0280435; MD5=d4bf4265cabaf07dc70ea4731a81634a; length=901; release=r2.13; species=Dpse;
Sequence
MSAAFVALLLLVASVAGCPPEVCICKWKGGKQTVECGAQQLANIPEGMDPGTQVLNFSGN
SLQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQHVPSETF
QDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLD
GNRIGFIQGSHILPKSLHGISLHSNRWNCDCRLLDVHSWLVNFNTPLAEEPKCMEPARLK
GQVIKGLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLWLFNGQVMSNDS
LMDNLHMFYYIDESIGSSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGTTFSNYTLRVI
IKEPPVVNEVSFPRDYMNYIVASSAGGGIIFVVLLCTIVVKCKRTAEPAKQRKKCDQVTS
IAGGTDSSAGSNQDTGMGMMKCASILNDGAESMTGNAGMLLGDTMTPTKATNGAAGGGII
LGGQMKQNLLLYAGPNQGQQQLQLNVNLMGSGAGSPPLLLGNGHGLAAAYCSPPASLRNY
QEKNPDLVNDAESVKHKLKTAVSLDGTGDYETSSDCGQYEGCYQLAAAAAAHPHPHQHPH
AHPLMGRFTQAMTTLPRGMQLKSVMAGTHQPAPHQVDVHLNPVCFLGQDGFAYDYSSAHL
VQQTPQQQQQQQQQQLQPAGPQPAANFYRTLPHNRLHKQQQFQGAAAPNSSLRYSLEAEF
IQRGPVSYEKYQMPNVRFTAEGYPQQQQLQQQQQQQFPSPPEGYKSDLSMLPAPFQQWPS
CLPGYRYAQSPTQAAISPTPQAQAPPPPPPAAAAAAAASTSTGTGTIPELDESEAISPRL
EETGAEDGAGAGAGAGAPPDASATEESAGGGDTSKLKQLNGPLADSPDEGYVGDGQETSD
I
Download sequence
Identical sequences Q29MX7
XP_001356502.2.19638 FBpp0280435 7237.FBpp0280435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]