SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0281453 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0281453
Domain Number 1 Region: 414-669
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-46
Family YWTD domain 0.0000059
Further Details:      
 
Domain Number 2 Region: 752-964
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-21
Family YWTD domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1516-1763
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-20
Family YWTD domain 0.0051
Further Details:      
 
Domain Number 4 Region: 1183-1218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 1224-1261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1097-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 360-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000571
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 1413-1455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000802
Family EGF-type module 0.017
Further Details:      
 
Domain Number 9 Region: 1310-1350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 10 Region: 1140-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 1360-1397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 12 Region: 100-137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 198-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 1445-1485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000018
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 15 Region: 239-277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 16 Region: 284-316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 17 Region: 1269-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 18 Region: 141-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 19 Region: 1055-1086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000628
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 323-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  FBpp0281453
Domain Number - Region: 1007-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000358
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 673-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0281453   Gene: FBgn0072529   Transcript: FBtr0283015
Sequence length 1994
Comment type=protein; loc=XL_group1e:complement(6144124..6144273,6144380..6146802,6146872..6149454,6149533..6149949,6150045..6150456); ID=FBpp0281453; name=Dpse\GA12483-PA; parent=FBgn0072529,FBtr0283015; dbxref=FlyBase:FBpp0281453,FlyBase_Annotation_IDs:GA12483-PA,GB_protein:EAL31942,REFSEQ:XP_001354886,FlyMine:FBpp0281453; MD5=24141c0b8ef9a5136224c0beae7ae034; length=1994; release=r2.13; species=Dpse;
Sequence
MCVVKETTEGTCSQHQGSEIYGRGRTMLTSDWQMLNLTSHTTTVCNGNGSTDNSSDNVRR
KRYGGHGLPQVSRRPLWWCRLAVLLLIFCALAAAASGPANTRCDEDQFQCRDGSCILQAK
MCDARSDCTDATDELDCDYKLCREPHWFPCAQPHGACLAAELKCNGIDNCPNGEDEINCP
SGILGMSSRFGSFRKLPRNCSASEYMCQRDRSCIPIEFQCDGKSDCADSSDELDGCKESQ
ASCKGHLCPNGRCLQRKQWLCDGVDDCGDGSDEHGCVDLCQPEMGKFMCRNKEHCLELAK
VCDGHSDCSDGSDEYETCNSKPDCSAKSCPAGATCHMMSTDGAQCYCPAGFRLAKFQNKC
EDIDECQERESELCSQSCENTSGGYRCSCDPGYLLAKDNRTCRAANTHGSDHPLLLYTTQ
MNVMGMHLGSRNHVYQVAGNLSKVIGVAYDGSHIYWTNIQNEAESIVKANADGTHAEILL
TSGLDAPEDLAVDWLTQNIYFSDNVMRHIAVCSHDALNCVVLVTEDVHQPRGLALWPQRG
QMFWTDWGVKPMIVRASMDGKRSTPIVSENIHWPNGIALDMHQQRIYWVDAKLGSVQTVR
PDGTGRRTVLDGMLKHPYGLAVYEDQLYWSDWGTKSIHACHKYSGKQHRVLAKDRTIYAV
HIYHSAKQPQTPNACATAKCSHLCLLAEPEVGGRSCACPDGMQLAPDQQRCMQTVKRQRL
FVGVGQFLLEIEHTAFGRHVVSASHALDIIISEMVYNSVNGTLIIADNERRMIAEYQPGL
GQGRLRTLIHSNLGNVSALAFDHLSQNLYWSDAERRVVELYSFHTRHRALIRFFAGQESP
IGLSVMPAEGYLYVALKARRHTHIDRLPLSGKGSPTHVFEEELGDDDIKMATDHDQHTLY
WSDSDMGMISYTDYRQTQSMTFRSKLRRPYSLALVHQDLFWSELGSSSIYWAHKSNMGPR
KRIDVVPTRGSGDTHGHSMFMEAAPWRLALASSAPPSTDREEQQQQQQHPCQHQNGGCSH
ICVGVGQLAATCLCPVGFVYRDASNRSCLEALDCEFRCRSSGECLTLAHRCNGRQDCVDR
SDEQDCDEEGHKHKPKVMCGPRQFACHNAEACVDKDKRCDGHKDCPDNSDEQHCLQFDKT
RSCHVHQLACDNGKCVDQSLMCDGKNDCGDNTDEDKAKCDSPANCDQGMFQCSNGACIAA
SWECDGRIDCSDASDEHDKCGHRRCPPDMHRCLLGQCLDRRLVCDGHNDCGDLSDELNCG
SGAHAKANISCGSLLYQCASNLKLCLDPAVRCNGTAECPRGEDEADCGDMCSINEFQCRT
GKQCIRKEFHCDRARDCLDGSDEEACDKIQNQTLSKPWTTASRACRPHLFDCQDGECVDM
SRVCNSFPDCQNGSDEGPQCATACRASAGGGRPVCQHKCRATPAGAVCSCFDGYRLDTDQ
RSCVDVNECLDGQPCAQICENTLGGYQCQCHADFMLRQDRVSCKSLQAGATLLFSSYNEV
RNLSEQPMMLQVAWSANDSRIDGFDVDMERQMGYFSSEEQGVVYQVDMRRRFIVRALAVP
SPTKVAVDWATGNVYVLAGGSASQEIYACSFPARMCGRILQVKTHMHLRHLAIDGYHGRL
FYIAMRLEGFGHASAELHVARLDGSHKELMLHKKDSYMTALALDPHQQQLYYLDMHSRTL
ERISYRTRSGMGPHRRPEMMLQKSNALKQPSGLSIYENHAYIVNLGSKEAVRCRLYGERI
CKSINLNVLNAQDIVVAGRSRQPMPTSNPCHHSQCHGMCILADYGYECMCGNQVVAEGEQ
CPHGSMNELEVGASRQERTQSTFHWWIMALLVLVMGSLAAGLGYMYYQWRQRGHTDLNIN
LHFQNPLATIGSKAFLDHERNEAIVNGMDGMASSHSSNETGTTSASSSFAAQQFGMPNVL
QRLLRPKQASSGSHMATDMLLENSRASELYTLDNGRKAGGVPVILVADNDDDTLTNGHFG
GDHTGDDANARLVP
Download sequence
Identical sequences Q29H17
FBpp0281453 7237.FBpp0281453 XP_001354886.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]