SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0282727 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0282727
Domain Number 1 Region: 471-685
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-29
Family Kelch motif 0.0068
Further Details:      
 
Domain Number 2 Region: 344-453
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-16
Family Kelch motif 0.0059
Further Details:      
 
Domain Number 3 Region: 136-270
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000275
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1008-1055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000285
Family Laminin-type module 0.044
Further Details:      
 
Weak hits

Sequence:  FBpp0282727
Domain Number - Region: 277-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000544
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0282727   Gene: FBgn0079017   Transcript: FBtr0284289
Sequence length 1381
Comment type=protein; loc=2:complement(3774153..3774307,3774370..3774451,3774517..3774603,3774674..3777521,3777592..3777739,3777799..3777956,3778028..3778264,3780225..3780655); ID=FBpp0282727; name=Dpse\GA19019-PA; parent=FBgn0079017,FBtr0284289; dbxref=FlyBase:FBpp0282727,FlyBase_Annotation_IDs:GA19019-PA,GB_protein:EAL27024,REFSEQ:XP_001357888,FlyMine:FBpp0282727; MD5=52df6c67ba893ed004bfb19c950e8cf6; length=1381; release=r2.13; species=Dpse;
Sequence
MCLVEHAGDQQKQPSSPVTSSTTSFCSNRNRNNNPSPSITIVNSQQQQQHHHHQSLRSGA
STSTPTTTTTSPTFNAKYRRKCLLLLTLLLFHGCFSGLHRASAYNCTAHGSRCQNDGQCQ
EDGQCLCADGWQGPECQFCGGKVRMYHPMGTIHDGWGNYSVSVKCSWLIDARHPHWGRRH
NANSPRTSNIRIHLREFATECGWDHLYIYDGDSVDSPLLAVFSGLMYRGNFSIRHVPQVI
ARSGTALVHFFSDDAYNMSGFNLTYKMNGCPTDSDEVECSGHGKCRDGDCICDPMYRGEA
CNMAACPGNCMEEKNQGHCRLDQERCICYDGFAGDDCSQVSAHGAWTTVHPKHSPAPAGS
ASHGATVWRDTLHIVGGESYGRGELMSTYDFNGNVWETVHPEDGGEVPDKRYGSSTVMYG
DKIFMYGGVIKGQGISNELWAFDVSAKTWENITVRTDACNVTTGPSGMCGPLHVVGHTAT
LVPGFGDKNNYQYMVVIFGHSPHYGYLNTVQEFNFGSREWRIVQTSGFVVKGGYGHSAAY
DFLTEKVYVYGGIVSESESSQVLSSRLYAYEPSTRIWSLLSSAPSARLLHTANFVNQGLM
MVFGGNTHNDTSTSYGAKCYSKDLLVYDVYCDSWHFHQMPSYLQADLARFGHSSVVFEDA
LYIYGGFNGQLLNDILRYQPGYCSYYTKQEKCTSARPGIKCIWDVQKMRCISITQVQRSA
IYGREQYDYVACPSKSRLTMTSELLHDVLRCQELGNCQSCVSTAFDCTYCGNGVCSKERC
RETTSVASVFLELSTTHQSVPQVPASTVGPPLNAKQLVACPVSEDFLMQSVCEQLHNCRA
CSSNAACKWDTEQNRCRSHGSSSTAGGPVSNRTQDDVVCPPACATLTNCQNCTEDECIWC
QNEQRCVDRNAYTASFPYGQCREWTTFTAKCRSSPVTALSIGTTTALSSAQCGYYNSCQQ
CLDDPACGWCDNGSNTGLGRCVVGGALAPYDETECALKHWFFTSCPRCNCNGHSVCNDQQ
HCEQPCNNLTTGVHCEKCRTGYWGSPINGGKCQRCECNDQGVYCHPDTGKCYCTTKGIVG
DHCEKCDSQNHYHGDPLKGSCYYELTIDYQFTFNLSKKEDRHFTQINFRNSPGKPEIDAD
FTITCSVPAKMDISVKRAGSPDMLILVGVNCSTFRHRFPKTEYQFGHSPDDNSSLTTFYV
FVHDFQPPIWIQIAFSQYPKLNLQQFFITFSSCFLLLLLMAAVLWKIKQKYDMFRRRQRL
FVEMEQMASRPFSQVLVDIENRESIDLSLTLEGIGHMSKKRKKECPSPIALEPCCGNRAA
VLSLLVRLPTGGQSQAPTGQSNGLAVASALVTLGPRRPSMEQHPKEPKSKRKQSQHPESC
T
Download sequence
Identical sequences B4GNY4 Q29BH4
XP_001357888.2.19638 XP_002020055.1.64850 FBpp0177882 7237.FBpp0282727 FBpp0282727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]