SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0284043 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0284043
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.93e-64
Family BAR domain 0.00000086
Further Details:      
 
Domain Number 2 Region: 286-362
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0284043   Gene: FBgn0064416   Transcript: FBtr0285605
Sequence length 369
Comment type=protein; loc=2:14855396..14856505; ID=FBpp0284043; name=Dpse\endoA-PA; parent=FBgn0064416,FBtr0285605; dbxref=FlyBase:FBpp0284043,FlyBase_Annotation_IDs:GA12885-PA,GB_protein:EAL28006,REFSEQ:XP_001358863,FlyMine:FBpp0284043; MD5=51f8eb3dfaeb666ad373ec91eb4afacf; length=369; release=r2.13; species=Dpse;
Sequence
MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMDMERKTDVTVELVEELQLKTKEFLQP
NPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGE
SLKQMADVKYSLDDNIKQNFLEPLHHMQMKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDD
EIRGAEDKFAESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQ
EKRSEAESRPRNEFVPKTLLDLNLDGGGGGLIDDGTPSHISSSASPLPSPMRSPAKSMAV
TPSRQQQPCCQALYDFDPENPGELGFKENDIITLLNRVDDNWYEGAVNGRTGYFPQSYVQ
VQVPLPNGN
Download sequence
Identical sequences A0A0R3NM62 B4G3P2 Q8I1C0
FBpp0284043 XP_001358863.1.19638 XP_002013377.1.64850 XP_015037404.1.19638 XP_017144247.1.22881 XP_017144248.1.22881 XP_017144249.1.22881 7237.FBpp0284043 FBpp0187547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]