SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0286346 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0286346
Domain Number 1 Region: 274-540
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-79
Family Protein kinases, catalytic subunit 0.0000000508
Further Details:      
 
Domain Number 2 Region: 157-303
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-35
Family SH2 domain 0.0000418
Further Details:      
 
Domain Number 3 Region: 91-206
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-22
Family SH3-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0286346   Gene: FBgn0249700   Transcript: FBtr0287908
Sequence length 551
Comment type=protein; loc=XR_group8:complement(2703364..2703978,2704035..2704342,2704417..2704670,2704739..2704955,2706576..2706837); ID=FBpp0286346; name=Dpse\GA28338-PA; parent=FBgn0249700,FBtr0287908; dbxref=FlyBase:FBpp0286346,FlyBase_Annotation_IDs:GA28338-PA,GB_protein:EAL30146,REFSEQ:XP_001352648,FlyMine:FBpp0286346; MD5=3ed395102669670ab67d7063b7a22c78; length=551; release=r2.13; species=Dpse;
Sequence
MGNHCCSKRQDQELALAYPTGGYKKSDYTFGQTHINSGSGVGAGGLVQKHNNGGSLDSRY
TPDPNHRGPLKIGGKAGVDIIRTRTTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGDR
MEVIDDTESDWWRVVNLSTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEEN
PRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALV
MAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYG
KWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSK
GSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKLLIHRDLAARNVLIGENNVAKIC
DFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPY
PGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSV
TSEVPYREVQD
Download sequence
Identical sequences B4H1S6 Q29EB5
FBpp0286346 7237.FBpp0286346 FBpp0182048 XP_001352648.1.19638 XP_002024805.1.64850 XP_017136776.1.22881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]