SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAZ82193 from Tuber melanosporum Mel28 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAZ82193
Domain Number 1 Region: 531-574,633-658
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000118
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 
Domain Number 2 Region: 238-340
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.0062
Further Details:      
 
Weak hits

Sequence:  CAZ82193
Domain Number - Region: 195-262
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00161
Family Eukaryotic type KH-domain (KH-domain type I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAZ82193
Sequence length 894
Comment pep:novel supercontig:ASM15164v1:FN430109:636472:640409:1 gene:GSTUM_00005858001 transcript:CAZ82193 description:""
Sequence
MATTLGLTSGIHHVLPQKPTFDVTSSSNVSDAVGGNDMLTSDEDNSTLESLTYAFSIPFS
FIPGPDPDQIILATSQARERWLHPPDSPPNLPTSRLPVHQKSINDVRELCKRLSPGLVAR
TTVSVTELTAETALRKKQTTSVGLWIAGEPAEVHKTRGLILQSVPVAMRNSCVNIDHDQY
YLSDGVPNTRITVHLERIAQFTGTDIFVLKPPEPTSIVAVDQGSEASQNRRLKISIFGDY
ESVEHAKTRVLIMIDDLLGQEVIPTFMELSVQSMICGRGRKNVKLIESATRTAIYFPPPF
PQVYGYSPPGGTRRDPDQIFITGSSREDIAKAERMLLNLTLGMRIFVKDVSITLTKIDYI
LLQRLDDVKKIMDANGTFVQLPVLGSPASLIRVQGSETLHLERTIKAIMVICGQFYNASW
WVMDSPIARLLPKALEVQKLLIDVAAFTGVSIAFNKQVFEFSGSDENVKAAMHMLSDVPF
NGKINKIMSQSNIQIIFDTFNEYNFFIDVCGGKFDTTMLGLKLVEQELPAAVSFHVPDSY
HKRIIGIGGQHIQRIMKKYSVFVKFSNAMERGASGRSESDGTKVDNVICRTPARNAANLE
LVKSEIMGMVQRADADIVQEHVDIPRLLHQMASDIVTIKGPQWQVPHAVHEFLALVPETH
IIRLKNSPELEELLKQDEFKKNITDRMNTQFGIRLHPTVDNATESPGGRRSGDGEDYMEI
TFTYTRNNAGALRDAIEMLTNFLLSHGIQTDSIKGALPRPKSDSFEDFVPFFHSAVFQKP
SQSRVGSSNGSIRRLSGDAGSIFGDQVLHTEPAQFTDTTEAAFYDGDRKASLSDAGLVRP
PGSSGSISSTRTSFSLGRKGSTVWEGGLEATGLPDGEEWTKLESDRSRSNSVTM
Download sequence
Identical sequences D5GCF0
GSTUMT00005858001 CAZ82193 XP_002838002.1.11696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]