SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51244467|ref|YP_064351.1| from Desulfotalea psychrophila LSv54

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51244467|ref|YP_064351.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000408
Family Coronavirus S2 glycoprotein 0.0083
Further Details:      
 
Weak hits

Sequence:  gi|51244467|ref|YP_064351.1|
Domain Number - Region: 62-195
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0366
Family Chemotaxis phosphatase CheZ 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51244467|ref|YP_064351.1|
Sequence length 224
Comment hypothetical protein DP0615 [Desulfotalea psychrophila LSv54]
Sequence
MEKYMTGLLLIMLFSLTSCASTYYGAMEKVGYHKRDIMVDRVKAAQESQEEAQEDFTSAL
QQFDSVVRLEDTDLKRAYESLNDEYESISDAAETVSNRIDRVELVADALFAEWEAELALY
QSASLRNKSKGQLRLTKAKYQTMIRSMHRAEASMDPVLKTFRDNVLFLKHNLNAQAIGSL
RGEFRSLKADINTLIKQMKQAIASSNAFIKDPSLAPATAMKMAL
Download sequence
Identical sequences Q6AQM9
gi|51244467|ref|YP_064351.1| WP_011187860.1.98904 177439.DP0615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]