SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0174469 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0174469
Domain Number 1 Region: 418-753
Classification Level Classification E-value
Superfamily L domain-like 6.46e-50
Family Internalin LRR domain 0.075
Further Details:      
 
Domain Number 2 Region: 115-439
Classification Level Classification E-value
Superfamily L domain-like 2.55e-47
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 3 Region: 837-1013
Classification Level Classification E-value
Superfamily L domain-like 4.08e-29
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 4 Region: 1094-1241
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.27e-22
Family Toll/Interleukin receptor TIR domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0174469   Gene: FBgn0147972   Transcript: FBtr0175977
Sequence length 1425
Comment type=protein; loc=scaffold_2:complement(8779281..8779784,8779852..8783625); ID=FBpp0174469; name=Dper\GL10362-PA; parent=FBgn0147972,FBtr0175977; dbxref=FlyBase:FBpp0174469,FlyBase_Annotation_IDs:GL10362-PA,GB_protein:EDW32586,REFSEQ:XP_002016696,FlyMine:FBpp0174469; MD5=2101cfb301e868b68e347308d85ff7ae; length=1425; release=r1.3; species=Dper;
Sequence
MEFPLLLPLVSVLLLGSASDWSCLAALAPKESGDNSASAMLGGGAGSASVSLSGDYSSLL
SAAMPPASADDSSPAAPAHSGPSNQCSWTYNGTSSVHCALRLIERQPGLDLQGADGSSQL
TIQCSDLYLFESTLPVAVFARLQTLETLRLEACKLLQLPNNAFEGLGTLKTLRLSSHNAE
WGPARALELYPDSLNGLKQLTELDMSDNNLRALPAGFLCPVGNLQALNLTHNRIRTAEQL
GFADMNCSGGSELQLLDASHNELRSITESWGISRLRRLQHLNLQHNNISELSGEALAGLA
SLRIVNLSNNHLETLPEGLFAGSKELREIHLQHNELYELPKGLFHRLEQLLVVDLSGNQL
TSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLP
LYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEQAVFKNCSDLKELDLSSN
QLNEVPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDL
PRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLSDINGVFATLVSLLWLNLSENHL
VWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIE
LLFINNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKALPEFYLGGN
PFECDCTMDWLQRINNLTTRQHPRVMDMPNIECVMPHARGAAVRPLSALKPQDFLCRYES
HCFALCHCCDFDACDCEMTCPHNCTCYHDQIWSTNVVDCGGQQTMELPRRVPMDSSIVYL
DGNNFPVLKNHAFIGRKNLKALYVNGSQVAAIQNRTFASLTSLQILQLADNRLQTLHGYE
FEQLSSLRELYLQNNLLATIENATLSPLVSLELLRIDGNRLVTLPIWQLHATHFGRRLRS
IALGRNQWSCRCQFLQALTSYVAENALIVQDAQDIYCMAAPNTAGYDAASYDSSSSEGSL
QKRELDFNSTGAACTDYYSGGSMLQHGIPESYIPLLAAALALVFLLVVIIIVFIFRESLR
IWLFAHYGVRVFGPRCEESEKLYDAVLLHSAKDSEFVCQHLASELETGRPPLRVCLQHRD
LAHDATHYQLLEATRVSRRVVILLTRNFLQTEWSRCELRRSVHDALRGRPQKLVIIEEPE
VAFEAESDIELLPYLKTSAVHRIRRSDRHFWEKLRYALPADYPTYRGNNYTLDHNHERQR
EAPPAPPQLQPSRTIPTATTATPSPRPQRRGDHHGGVSGSGAAAAPHGHHLHAQYYQHHG
MRPPSEHIYSSIDSDYSTLDNEQHMLMMPAGPVVSLEGTPRAQTWRPKQQQQQQPGLQSG
PSSVGHVATMGPSGKTPPQQQQQQQQQQAVGSGQQQGPHVQAYLV
Download sequence
Identical sequences B4GD91
FBpp0174469 XP_002016696.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]