SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0174596 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0174596
Domain Number 1 Region: 51-182,209-321
Classification Level Classification E-value
Superfamily L domain-like 2.18e-22
Family Internalin LRR domain 0.02
Further Details:      
 
Domain Number 2 Region: 374-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-16
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0174596   Gene: FBgn0148099   Transcript: FBtr0176104
Sequence length 462
Comment type=protein; loc=scaffold_2:complement(7094021..7094621,7094635..7095422); ID=FBpp0174596; name=Dper\GL10489-PA; parent=FBgn0148099,FBtr0176104; dbxref=FlyBase:FBpp0174596,FlyBase_Annotation_IDs:GL10489-PA,GB_protein:EDW32335,REFSEQ:XP_002016445,FlyMine:FBpp0174596; MD5=abc2f02d378866c4cf15750be00d10a4; length=462; release=r1.3; species=Dper;
Sequence
MPSLLEALERKYFSECEFENAHEPELHKRADLPNDFTVTKCGGRMEFSIFIPRLSPLTSV
PALLVLNDCDIDSAGDFESIQEKCQRVRELDLAQNKLSDWQEVFNILKHMPRIEFLNLSK
NQLGSPLRSLAEAPVINLKSLVLNGTYLDWQCVDALLQNLPVLQELHLSLNNYTNVLIDA
EEAERRLQEDGEAGQCDCPKEKRRITKAHPALKTLHFTGNPIEHWQEICRLGRLFPNLEA
LVLADCPIRSLQAEESRDCDSHNLKLLNLSSAQLNCWSAIDELAKFQQLQNLRVKHWPLW
ENLECTEHERRQLLIARLPNVEMLNGGGKIGTDERIDAERAFVRHYMDKPEAERPARYKE
LLQVHGKLDPLVDVSLKPDKRVKVIFNYGELRESRFVDIYLTVNDLKAKLEKLVNLPPNK
MRLFYLDQDYKEFGPEEMRFPNKKLYSYNIQSGDEIIIDAKK
Download sequence
Identical sequences B4GBS7
FBpp0174596 XP_002016445.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]