SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0176480 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0176480
Domain Number 1 Region: 89-433
Classification Level Classification E-value
Superfamily L domain-like 7.74e-46
Family Ngr ectodomain-like 0.017
Further Details:      
 
Weak hits

Sequence:  FBpp0176480
Domain Number - Region: 487-532
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0497
Family Chemotaxis phosphatase CheZ 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0176480   Gene: FBgn0149980   Transcript: FBtr0177988
Sequence length 543
Comment type=protein; loc=scaffold_6:869722..871353; ID=FBpp0176480; name=Dper\GL12373-PA; parent=FBgn0149980,FBtr0177988; dbxref=FlyBase:FBpp0176480,FlyBase_Annotation_IDs:GL12373-PA,GB_protein:EDW38005,REFSEQ:XP_002019371,FlyMine:FBpp0176480; MD5=75f1a326ab1175231b25ccd2e3ce1d4b; length=543; release=r1.3; species=Dper;
Sequence
MYVRNCLEVWSLVSVLVALVASAEITPDLIRVESLADHCLVQAEQTRCSGFNFDREDERA
SFDLQTEVRITPDGSTYEVVGDDQPTGALIFENCTFVHFPERLLYSLEVTELDMRSCGIR
HMRWDSFALGAEKLVILLLSDNLLEELNDKSFFGAGNLQFLFLNQNRIRSLDTDTFDGLQ
SLQYLNLIENQLEELPPRIFDDLKSLQTVLLAQNLLTTVAGDLFAYNPRIHSVSLHTNRL
EDLQEYAFRVGQEHRLHSLDLSHNPRLTVLLLNLNASRLSVRNCSLDRVNLYGSVTEVDL
SDNRVRELYFPASETLEYLVLRNNSLVQMASLTRVPRLRHLDVADNPQLAPLPEGWQTPE
LELLDLRSTGQQELPLAALQGMPQLRKLDISGNNLTDIDPTAFPLLSQLTHFYLHANNWN
CFSLRTIMDMLIRPNGITYTVDAVDPDFPGEYIHGIACMYRQPEREPLGGYSSTETESGY
SASVERESEPSEAEKLRKELQAVVQYFEAKFDKIMEALEQLNDRMSSIERLNHTIWNTVT
LSV
Download sequence
Identical sequences B4GMD1
FBpp0176480 XP_002019371.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]