SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0176576 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0176576
Domain Number 1 Region: 587-780
Classification Level Classification E-value
Superfamily NTF2-like 4.27e-24
Family NTF2-like 0.0046
Further Details:      
 
Domain Number 2 Region: 435-579
Classification Level Classification E-value
Superfamily L domain-like 9.18e-21
Family mRNA export factor tap 0.011
Further Details:      
 
Domain Number 3 Region: 804-852
Classification Level Classification E-value
Superfamily UBA-like 0.00000000485
Family TAP-C domain-like 0.015
Further Details:      
 
Domain Number 4 Region: 176-286
Classification Level Classification E-value
Superfamily L domain-like 0.0000351
Family mRNA export factor tap 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0176576   Gene: FBgn0150075   Transcript: FBtr0178084
Sequence length 853
Comment type=protein; loc=scaffold_6:join(2444330..2444578,2444637..2445092,2445146..2445430,2445485..2445586,2445644..2446801,2446861..2447172); ID=FBpp0176576; name=Dper\GL12469-PA; parent=FBgn0150075,FBtr0178084; dbxref=FlyBase:FBpp0176576,FlyBase_Annotation_IDs:GL12469-PA,GB_protein:EDW38213,REFSEQ:XP_002019579,FlyMine:FBpp0176576; MD5=836523bf992c82a94b66c622562b0c21; length=853; release=r1.3; species=Dper;
Sequence
MSKGQRYVLNFSDGSLPIQVDYPDPRIFRNCSTYGDRVPGLSWNEFSIHHLGQLEYLENP
KQVILEAIFDVIDGEEFYPVAYECGPRADKFVARACKPAIDKLFAQKLCLRLSSGATVDI
SVQFGVAANRSKQISPPLLISQEVSRLMERLEVHSGVRGVLNLSNFGANPCFKNIVVSLA
NVATLKHVCNSIYHNDEHFSAVNGFIFANNHMKSVDPLKLFGDIEYGLLDLSENKIGSSV
RLCRELKRVRAKELKLANNPITKGPKYPNNIKALQGNFSMVDGIPYDKLHKTYTPLNYDI
DLESDGIRIDWTNKSKLADFEHSEDWHAFLVPDPMHALTETCLFRLFFLTANQFLSEIYP
CYYKFDGKEHIFLVRNCFEQIAYLVHSCNLEIPIPVTVTNVEDPDVCMGPRTIPFYLRMN
VSRFKLHHVDPQERITKCIQKCYVAQNQLLKMSDFQANEGLKGLWVHMGSTRILNNILTI
ISRQFMSNCSEIRLCNNNIFRIDAARVLSRMGSLRALDLGHNWINDLEDIKALGELPLKS
LRLHGNPLCRKYGLPNDYIQAVKKIFPQLTTLDGVDLSSKPGQAPQKNFLCDIGAYELVG
DVFLSNYLREFEQADMRANRLMKYYTEDSIFTMTCNYVMGRSQSFNAQLFKRISKYTKHS
RDIKKWSDYTKATNEFHVGLMEIIGVLMELPSIVHDFLSVQTDVMHYNGQSAVIHVTGLM
RDDSPTTHNQAELYLAFTRNFVLKVDKQGLGFGKKACRWKISNDHLSIMNPSRKQLEGAF
KVCPLPKDRLMAPASEDSLDAKSHKLILFQQLTGLTSPWCTRIVESAEWDFERATKMFLE
MKENREIPELAFI
Download sequence
Identical sequences B4GMY9
XP_002019579.1.64850 FBpp0176576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]