SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0176595 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0176595
Domain Number - Region: 114-174
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0357
Family Bacteriorhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0176595   Gene: FBgn0150094   Transcript: FBtr0178103
Sequence length 215
Comment type=protein; loc=scaffold_27:join(667305..667319,667463..667545,667606..667840,667904..668218); ID=FBpp0176595; name=Dper\GL12488-PA; parent=FBgn0150094,FBtr0178103; dbxref=FlyBase:FBpp0176595,FlyBase_Annotation_IDs:GL12488-PA,GB_protein:EDW30908,REFSEQ:XP_002025397,FlyMine:FBpp0176595; MD5=bf98a105f0a4d8f7eba9550d9e7443cf; length=215; release=r1.3; species=Dper;
Sequence
MASATVPLLDDDTIPFGEEDEMRDPSRAGEKYTHPYVTFFHLFFRGAAIVIYMFCGWFSD
SFITSFVFVVLFLSADFWTVKNISGRLLVGLRWWNYVDDDGVSHWVFESKNSRINKHEQR
IFWLGLILCPVFWGLFFLMALFGLKFKWLLLVMIAIALNAANLYGYIKCNYGAGKDLNSA
ATDFVKTQLFKNAMDIMTKPSTAQPPTNVRPTGIV
Download sequence
Identical sequences B4H3G8 Q2LZQ2
7237.FBpp0274315 FBpp0274315 XP_001353721.1.19638 XP_002025397.1.64850 XP_017138857.1.22881 FBpp0176595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]