SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0176670 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0176670
Domain Number 1 Region: 185-453
Classification Level Classification E-value
Superfamily Caspase-like 1.26e-62
Family Caspase catalytic domain 0.0000822
Further Details:      
 
Domain Number 2 Region: 10-108
Classification Level Classification E-value
Superfamily DEATH domain 0.00000442
Family Caspase recruitment domain, CARD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0176670   Gene: FBgn0150169   Transcript: FBtr0178178
Sequence length 457
Comment type=protein; loc=scaffold_27:join(767010..767471,767536..768447); ID=FBpp0176670; name=Dper\GL12563-PA; parent=FBgn0150169,FBtr0178178; dbxref=FlyBase:FBpp0176670,FlyBase_Annotation_IDs:GL12563-PA,GB_protein:EDW30919,REFSEQ:XP_002025408,FlyMine:FBpp0176670; MD5=1c8af4b14b654f72ffc36226a07bc24d; length=457; release=r1.3; species=Dper;
Sequence
MQHSRREIGMLQKHRDHINEHLDELVKCTNYTRIREECVRINLLSPDMLRNVEDLSGAGF
NMSKEDSQLEQHRRLLIKITKRGPAAYNQLITVLRNVGSLQAVKLLEDVSEQNSGSPFIS
INERKITRKSADIVDTPSPSPTATADRNGACVSKREYNEAGGPLIPYTEPVDGQKRDVKK
SDRVHTDEVVGTYNMQSQHYRGVLLMINIIDFPDTERKRNGAEVDSDSLIHLFREMGFTI
FAYNNMNQEQFFDTLGKVTSSKYAQQTECFVMVLMTHGERVGEMDKVEFGDGSVVDVHKI
KNYFQASVSPYLVHKPKVLIFPFCRGREADLGQRINHFDSIGTAASRLSRQEETVVETEG
RPSTYTNVPSLSDTLVCYASTPGYVTHRDAESGSWYIQTFCDMMADHAHNTPVEDILKKT
NELVGHMRTSKGSMQTGSFDNLGFNKKLYFNPGFYTE
Download sequence
Identical sequences B4H3H9
XP_002025408.1.64850 FBpp0176670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]