SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0177014 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0177014
Domain Number - Region: 32-50
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0177014   Gene: FBgn0150513   Transcript: FBtr0178522
Sequence length 67
Comment type=protein; loc=scaffold_13:complement(1585677..1585844,1589480..1589515); ID=FBpp0177014; name=Dper\GL12907-PA; parent=FBgn0150513,FBtr0178522; dbxref=FlyBase:FBpp0177014,FlyBase_Annotation_IDs:GL12907-PA,GB_protein:EDW26580,REFSEQ:XP_002022545,FlyMine:FBpp0177014; MD5=0ec4f4eca1df18173969dd1154690ee9; length=67; release=r1.3; species=Dper;
Sequence
MQRLPTAAFRIQSARRRKPEEEWASGSEEAQGIQQQRPQQQQQQQQQKQPPEGRLMYRTM
ESSHAGA
Download sequence
Identical sequences B4GV43
XP_002022545.1.64850 FBpp0177014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]