SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0179825 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0179825
Domain Number 1 Region: 208-366
Classification Level Classification E-value
Superfamily NTF2-like 6.76e-30
Family NTF2-like 0.0014
Further Details:      
 
Domain Number 2 Region: 61-192
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000215
Family mRNA export factor tap 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0179825   Gene: FBgn0153322   Transcript: FBtr0181333
Sequence length 1391
Comment type=protein; loc=scaffold_47:join(273039..273085,273191..273291,274755..276086,276280..276335,276410..277714,277879..278802,278886..279044,279121..279372); ID=FBpp0179825; name=Dper\GL15718-PA; parent=FBgn0153322,FBtr0181333; dbxref=FlyBase:FBpp0179825,FlyBase_Annotation_IDs:GL15718-PA,GB_protein:EDW35212,REFSEQ:XP_002027326,FlyMine:FBpp0179825; MD5=336fc0d1e047d8580739ce65924995ad; length=1391; release=r1.3; species=Dper;
Sequence
MDILDIDEALKDDSSIFLADKNHDDVSNILQQWKTNNQPPLYSQYNNEQEFEAAAKDALH
SSYDDATRTLNLSRFHAKPELGVHFCPLYVDKFLVGVLRLISKETPQVSKIVLSDNYLCS
LKAFSEIPNGLLAGLDCLDISSNKIGDLRDLQYLANLKLKSLIVQGNGVANLKNDILAIL
PQLQNLQGCRQSQNKENVSMGRPKLKLFGSAVPENFVNTFIKDFYQFFDHPDQRSQLEQR
YHELATFSLSVPDTMKHVLAYRLYNRNCKTPQSAFARSAKLQVGPKAVVHALGRLPKMET
YLQGVNVDGQMSTAHVRIFTITGRFMEYSSTGRDLRNFQRSFVLELQESSSVWVIKNDML
CIIPLIEGKSVERNIKALSESQVDSGLEMAAQMEKMNIKMATPPLISTIPKSLREETILK
KIKAVPPILPIPPPELNEFENMPRLILRGARSHSNDQLPDKNDVSDLEKEIDDTLLTDDS
DELIINEDVLFAESYKHNSKTFTRPKRRNLDFVQNASSINESGPGTGAVSGTPTMLQLEI
GGLVTTNMHKSFLQDTSPPSSICSSMNTERMNNSLITSADFSNLNFLQSTISLQQELSLT
TTLINQTDNGINGGLVNGGGGAGYTLSDMIRDRKALESLTMCEEDGTLIKDSHIGQTDEI
SLTLSKTASGCSTMDNSTESMSNPLATDRTILMPAVPAVYAPALSVVLGEEMIGDTTFNL
VDSLTTCTPMLQSESESLSVDGNTTFKRVAATPASTSVTASSDETQILAGRQMNTTFTDG
CNTPEGRCETPENIDRKLASLTMESSTPLTTSIRSHYYHNNNNNNNNKQGYTPTLKGRGG
MVDVDMNLSPIVGHTPQKGAGAGGRLNNTFETVAKAAVPFDGEKFVLDTMEILEQIEQPL
DGTYSLQMSEQHRQMQCVMDLAEAEVEMLAQQGDEEQFEHMLAELGKSHSSNSSSSAGER
LLSRRSRLYDDVNLSGMHGSNGSSASCNSASFIVQRREMPQEEQAAPDTVPKPEEEEQQQ
QTSYKLAERRERDRDRFKTIKITKEMRMRDDSQQEIIVPCIDDDPQQQLAEEQTEGEDLP
TQRQGSEPGRLSRRDQNPSVYYNNSNKAESSSSNYLTYKKPKEKSLLNRRQVPQEAQIAE
KSSTASTLPQPRSLSRPRYISGLQKFSMVSKATSAGAGLNATPAAAAPTTVTATATSSGE
LKSPMGTKSKSFHNLSSTMSGIGAPRPSLGGGLRRPGQQPSKLMGGLRGPVQAQEDEAAV
FKVPKLVSGLRGPPLAGAKRTVGNGLARPSSGYYSLSVKTAPEAETPESLSSASSRGSLY
GYKDNSKSAAASNGGNVPQPNSSHMFDTQVLSSKLTQVTTGGTGIPKPSGLRPPSQMKRS
GLPRPSSIVRR
Download sequence
Identical sequences B4H8Z7
FBpp0179825 XP_002027326.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]